(data stored in ACNUC7421 zone)

EMBL: CP000438.PE260

CP000438.PE260       Location/Qualifiers
FT   CDS_pept        complement(285213..288272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15211"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV2"
FT                   /protein_id="ABJ15211.1"
FT                   /translation="MRQRDLKFTFVVGEGKLAFDVVEFELEEALCEPFRLNLKLASDKN
FT                   AIDFKQVLDQPGTFTLWQDGRPARYVHGIVSHFTQGSSGFRRTRYELLLEPQLARLELC
FT                   CNWRIFQEKSVPEILQALLKEHRVLDYEQRIYHEHLPREYCVQAGDSDHYLHDRLAFEE
FT                   GLVYYFRFDEHRHTLVCSDRLYVQERIAGGPVLFSAQPEGDNPQPVLHSFRYSENVRTA
FT                   RQTQRDYSFKRPTYDQEHHLAGEALEHQDSSYERYDYPGRYKQSGAGRPFSESRLRGHR
FT                   RDARVASVSGDDPRLIPGHAFALEGHPRADFNAWWRPVRVVHRGTQYAGQEEESADAPL
FT                   GVSYDLRAELVPEDVEWRPAPLPRPRIDGPQIATVVGPAGEEIHCDEWGRVKVQFPWDR
FT                   EGRHDEFSTCWIRVAQNWAGADWGNMAIPRIGQEVIVDYLDGDCDQPIVTGRTYRATNR
FT                   PPYALPDHKILSTIKSKEYKGSRANELRIDDTTAQISAALMSDHGASALHLGYLTHPRP
FT                   EGGKPRGEGFELRTDEHGAVRAARGLLLSTEEQLRAGAGHLDRGVVVQVLEAALELARE
FT                   LGDYAGEHQGVGHDAAPQQTLQEAVRDLGHGANDESGKSNGGKPAIALSGPAGIAAATP
FT                   TSLTLAAGEHVDSVARQNQQVTAGQKVVINAGSDIGLFAQGGELRQITHQGPMLLQAQK
FT                   NDIRLEAEQSVEVSASQQHVLVTAKEHITLMCGGAYLTLKGGNIELGMPGNFVVKAAKH
FT                   SHVGAASLEAELPQFEVGETQRRFVLKQLDGQTAMPNVPYTITMANGEVIEGVTDAEGA
FT                   TQLLQKDAMNIAKVDMKHTRSPASAVAGIAAAVGAAVAVGKLLSGPDAEAGRALSEGEI
FT                   SLAKDVFGDSIDYSTVRLRDEDYVPWQGKDYVMAPNGHIYFGEELRGVADWSLESLQRQ
FT                   GLFIHEMTHVWQHQHGVNVLLVGAYQQARQFLLGDQYAYRLEPGKTLKDYNIEQQGDIV
FT                   RDYFLEKNEFGEASANSRFAGVLKNFPTGY"
     atgcgtcaaa gggacctgaa attcaccttc gtcgtcggcg aagggaaact cgcgttcgat        60
     gtcgtcgagt tcgaactgga agaagcgctc tgcgagcctt tccgcctgaa cctgaagctg       120
     gccagcgaca agaacgccat cgatttcaag caggtactcg accagccggg caccttcacc       180
     ctctggcagg acggccgtcc ggcccgctac gtccatggca tcgtcagcca cttcacccag       240
     ggcagctcgg gttttcgccg gacccgctac gaactgctgc tggaaccgca gttggcgcgc       300
     ctggagctgt gctgcaactg gcggatcttc caggagaaga gtgttccgga gattctccag       360
     gcgctgctca aggaacaccg ggtgctcgac tacgaacagc gcatctacca tgagcacctg       420
     ccgcgcgaat actgcgtgca ggccggcgac agcgatcact acctgcacga ccggctggct       480
     ttcgaggaag gcctggtcta ctacttccgc ttcgacgaac accgccacac cctggtctgc       540
     agcgaccggc tctacgtcca ggagcgtatc gccggcggcc cggtactgtt cagcgcccag       600
     ccggagggcg acaacccgca gccggtgctt cattccttcc gctacagcga aaatgttcgt       660
     acggctcgac agacccagcg ggactacagc ttcaagcgcc cgacctacga ccaggagcat       720
     catctcgctg gcgaggcgct cgagcatcag gactcgtcct acgagcgcta cgactacccc       780
     ggtcgctaca agcagagcgg cgcgggccgg cctttcagcg aaagccgcct cagaggacat       840
     cggcgcgatg cacgggtggc atcggtcagc ggcgacgacc cgcggctgat cccgggccac       900
     gcctttgccc tggaaggtca tccgcgtgcc gacttcaacg cctggtggcg gccggtgcgg       960
     gtggtccatc gcggcaccca gtatgccggc caggaggaag agtccgccga cgcccctctg      1020
     ggggtgagct acgacctgcg cgccgaactg gtgcccgagg acgtcgaatg gcgtcccgca      1080
     ccgctgcctc ggccgcgtat cgatggtccg cagatcgcga cggtagtcgg cccggcaggg      1140
     gaagagatcc attgcgacga gtgggggcgg gtgaaagtcc agttcccctg ggatcgcgag      1200
     ggacgtcacg atgagttcag tacctgctgg atacgggtcg cgcagaactg ggcgggtgcc      1260
     gactggggaa acatggcgat cccgcggatt ggccaggagg tgatcgtcga ttacctggac      1320
     ggcgactgcg accagccgat cgtcaccggg cgcacctacc gggcgaccaa ccgaccaccc      1380
     tacgcgctgc ccgaccacaa gatcctcagc accatcaaga gcaaggagta caagggcagt      1440
     cgggccaacg agctgcgcat cgacgacacc acggcgcaga tcagtgcggc gctgatgagc      1500
     gaccacggtg ccagcgcgct gcacctgggc tacctgaccc atcctcggcc cgaaggcggc      1560
     aagccgcgcg gcgagggctt cgaactgcgc accgacgaac atggcgcggt gcgtgcggcc      1620
     aggggcctgc tgctgagcac cgaggagcag ctcagggccg gcgccggcca tctcgaccga      1680
     ggcgtcgtgg tgcaggtgct ggaggcggcg ctggagctgg cccgcgagct gggcgactac      1740
     gccggggagc accagggcgt ggggcacgac gcggcgccgc agcaaaccct ccaggaagcc      1800
     gtgcgcgacc tcggccacgg tgccaacgac gagtccggca agagcaacgg aggcaagcca      1860
     gcgatcgcct tgagcggtcc ggcagggatc gccgcggcga cgccgacgag cctgaccctg      1920
     gccgccggcg agcacgtcga cagcgtggcc cggcagaacc agcaggtgac cgccgggcag      1980
     aaggtggtga tcaacgccgg cagcgacatc ggcctgttcg cccagggcgg cgagctgcgc      2040
     cagatcaccc accaggggcc gatgctgctg caggcgcaga agaacgacat ccgcctggag      2100
     gccgagcaga gcgtggaggt cagcgccagc cagcagcacg tgctggtcac cgcgaaggag      2160
     cacatcaccc tgatgtgcgg cggcgcctac ctgaccctca agggcggcaa catcgagctg      2220
     ggcatgcccg gcaacttcgt ggtcaaggcg gcgaagcaca gtcatgtcgg cgcggccagc      2280
     ctggaagccg agctgccgca gttcgaggtg ggcgagacgc agcggcggtt cgtcctcaag      2340
     caactggacg ggcagacggc catgcccaac gtgccctata ccatcaccat ggccaacggc      2400
     gaggtcatcg agggcgtcac cgacgccgaa ggcgccaccc agctgctgca gaaggatgcg      2460
     atgaacatcg ccaaggtcga tatgaaacac acgagatcgc ccgcctccgc agttgccggg      2520
     atagcagcgg cggttggcgc ggcggttgca gtcggcaagc tcctgagtgg ccccgacgcc      2580
     gaggccggac gtgctctcag cgaaggggaa atcagcctgg cgaaagacgt attcggcgac      2640
     tccatcgact attccacggt ccgcctgcgc gacgaggact atgtcccctg gcagggcaag      2700
     gactacgtga tggcgccgaa cggccacatc tacttcggcg aggagttgcg cggcgtggcg      2760
     gactggagcc tggagagcct gcagcgccag ggcctgttca tccacgaaat gacccatgtc      2820
     tggcagcacc agcatggcgt caacgtcctt ctggtggggg cctaccagca agccaggcag      2880
     tttctcctag gcgaccagta cgcctaccgg ttggagccgg gaaagacgtt gaaggactac      2940
     aacatcgaac agcagggaga catcgttcga gattatttcc tcgagaagaa cgagttcggg      3000
     gaagcctctg cgaacagcag gttcgctggc gtactgaaaa acttcccaac gggatactga      3060
//

If you have problems or comments...

PBIL Back to PBIL home page