(data stored in ACNUC7421 zone)

EMBL: CP000438.PE262

CP000438.PE262       Location/Qualifiers
FT   CDS_pept        291568..293184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15213"
FT                   /db_xref="InterPro:IPR021804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJP9"
FT                   /protein_id="ABJ15213.1"
FT                   /translation="MAQAIPAIEQAHPPGQIRIMRPRLTSVVSCWDYLWKVAAMEESAQ
FT                   QRSERYVSARSQHPAWLLLASRRAPLVLGCLRTLFERAHDGIPMEDALQALSEMLAAYA
FT                   SQELYEIDPDATHLQAGRELREWIKRRLVVEREGRIYATDALESAIQFVDSLDSRIMTS
FT                   TASRLSVVQREIENLETGLNPSPTGRIASLRRRIQDLEHELARVEAGHVDVLDEAQAIE
FT                   GMREVYNLATSLRADFRRVEDSWREADRALRHSIISEQSHRGEIVDRLLDGQDALLNTP
FT                   EGRVFESFQQQLRQSAELEVMRERLRTILRHPAVPKALNRPQQRELRWLALRLVRESQA
FT                   VLQARARSERDVRGFMKTGLAAEHHRVGQLLNDFFNLALSVDWQRQSERRKPACLPPVG
FT                   VAITGVPAIERLRFKTLDDDDAGELDLSLKPAGLEQIDDDFWDAFDGLDREALIHDTLA
FT                   VLVEQGRPVSLGELASLLPPAHDLETFALWLAMAREAGIEVLTEERQFVELVDEDEQRW
FT                   GFNLPYVGLDHEALKDIDWEL"
     atggcgcagg ctattccggc gattgaacag gcccatccgc caggacaaat acgtatcatg        60
     aggccacgac tgacttcggt agtctcgtgc tgggactacc tttggaaagt ggccgccatg       120
     gaagaaagcg cacaacaacg ctcggaacgt tatgtctccg cccgcagcca acaccctgcc       180
     tggcttttgc tcgcatcacg ccgagcgccg cttgtgttgg gttgcctgcg aacgctgttc       240
     gagcgggcgc atgatgggat ccccatggag gatgcgctgc aagcgctgtc cgaaatgctg       300
     gctgcttatg ccagccagga gctctacgag atcgacccgg atgcaacgca tctccaagca       360
     ggtcgtgaac ttcgtgaatg gatcaagcgg cgcctcgtcg tagaacgaga ggggcgtatc       420
     tacgcaaccg acgcgctgga gtccgccatc cagttcgtcg actcgctgga tagtcggatc       480
     atgacctcca cggcatctcg cctttcggtg gtccagcgcg agattgaaaa cctggaaacg       540
     ggtctgaacc ccagcccaac tggccgtatt gccagcctgc gccgcagaat ccaggatttg       600
     gagcacgagc tggcgcgggt agaggccggc catgtcgacg tgctggatga agcgcaggcg       660
     atagagggca tgcgcgaggt atataacctg gccaccagcc tgcgcgcaga ctttcgacga       720
     gttgaagact cttggcgcga ggcggatcgc gcccttcgac actccatcat cagtgagcag       780
     tctcaccgtg gagaaatcgt cgatcgattg ctggatggtc aagatgctct actcaacaca       840
     ccggaagggc gtgtgtttga aagcttccag cagcaactga ggcagtccgc tgagctggag       900
     gtcatgcgtg agcgcttgcg caccatcctt cgtcatcctg cggttccaaa ggcgctgaat       960
     cgtccccagc aacgtgagct acgttggctg gcgttacgcc tagttcgtga gtcgcaggct      1020
     gtgctccagg cgcgcgcccg aagcgagcgc gatgtccgcg gcttcatgaa aacggggctg      1080
     gccgccgagc atcatcgcgt cggacagtta ctcaacgact tcttcaatct agcgctcagc      1140
     gtcgactggc aacgtcagtc agagcgccgt aagcctgcct gtttaccacc ggttggcgta      1200
     gccattaccg gtgtcccggc aatcgagcgt ctccgcttca agactctgga tgacgatgat      1260
     gcgggcgagc tggatctgag tttgaagcct gcggggttgg agcagattga tgatgacttc      1320
     tgggatgcct tcgacgggct ggatcgtgaa gcgctgattc atgacaccct ggctgtgctg      1380
     gtggagcagg ggcgccctgt gagtctcggg gagcttgcgt ctttgcttcc acctgctcac      1440
     gacctggaaa cctttgcgct ctggttggcg atggcgcgtg aggcaggtat cgaggtgctg      1500
     acagaggagc gtcagttcgt ggagctagtt gacgaggatg agcaacgctg gggcttcaat      1560
     ctgccttatg tcggactcga ccacgaggca ctcaaggaca tcgattggga gttgtga         1617
//

If you have problems or comments...

PBIL Back to PBIL home page