(data stored in ACNUC7421 zone)

EMBL: CP000438.PE263

CP000438.PE263       Location/Qualifiers
FT   CDS_pept        293187..293936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03265"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15670"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL66"
FT                   /protein_id="ABJ15670.1"
FT                   /translation="MAGIFDRIAGASGADETELTAEPMALDDGMDGEQPAMSANIQVDE
FT                   RRTPQRVREAVQEMLKYGLLEESHKPNLYRSALTNIEVVDRILEPLDLAMGVDEVRGLV
FT                   FVTVRQGEVAEQDDWSHPLVRRQRLNLEQSLLIAILRQHFIAYEQESGTGASQALVAVD
FT                   ELIPQLQVYLGELGSEAKERNRIITLLDQLKGHGLVSALDAHDRVIIRPIITHLANPEN
FT                   LQALVVWLREQVEGAVTPAAGGEEDEA"
     atggcaggga tcttcgatcg aattgcaggc gcttctggcg ccgacgaaac ggagctgacg        60
     gcggagccca tggcgttgga tgacggcatg gatggtgagc aacctgccat gagcgccaat       120
     atacaggtcg atgagcgacg gactccgcaa cgggtacgtg aggccgtaca ggaaatgctc       180
     aagtacgggc tgctggaaga aagccacaaa cccaacctat atcgctcagc gctcaccaat       240
     atcgaggtgg tggacagaat cctggagccg ctcgaccttg ccatgggggt cgacgaggtt       300
     cgggggctgg tgtttgttac cgttcgccag ggcgaggtgg ctgagcagga tgactggtcg       360
     caccccctcg tgcgtcggca aagactgaat ctggagcagt ccctgctgat agccattctg       420
     cgacagcatt tcatcgcgta cgaacaggaa agcggtacgg gcgctagtca ggcgctggtg       480
     gcggttgatg agctgattcc ccaattgcag gtttacctgg gcgaactggg cagtgaggcg       540
     aaggagcgca atcgcatcat cacgctgctg gatcagctca aggggcatgg tttggtgtcg       600
     gctctggacg cacatgatcg tgtcatcatc cgtcccatca ttacccactt ggctaacccg       660
     gagaacctgc aggcactcgt agtatggctg cgagagcagg tggagggtgc ggttacgccg       720
     gctgccggtg gtgaggagga cgaggcgtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page