(data stored in ACNUC7421 zone)

EMBL: CP000438.PE264

CP000438.PE264       Location/Qualifiers
FT   CDS_pept        294101..297238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN9"
FT                   /protein_id="ABJ15214.1"
FT                   /translation="MTLLCANPRYNLASTGGHESDRDLVSYVRGVTGPGDGGVEQSHIA
FT                   RQGKTVTAIAATLERDGAQVRLGAVLWFEGTSSSASDLKKLWLLSESPEQTLEHWLSQH
FT                   HAGGMRALRQMEKDGMGIWPYPSKKAFLARLRDYFEVGENAFTLLNRAAGLKQLNSIDE
FT                   IFRELVLDDRSAFERAAEVASSFDDLTDIHRELETARKQQRSLQPVADGWERYRALQEQ
FT                   LQDKQALEGILPVWFAEQGYRLWLAETNRLEKEHKQAELDQAQCRSQLEIQKGVVDQHR
FT                   QRYLRVGGAGIDQLRGRIADWVRECDKRRLKAEQYQRLAKGLGLADELSAAALEENQQQ
FT                   IAARLEILAQQTTDARQKAFDAGLVQQELNGRLQSLQQERAEVERRPGSNLPGHFHAFR
FT                   GDLAQELGVDESALPFVAELVQVKPEELAWRGAIERAIGSHRLRILVPQGSSQAALRWV
FT                   NQRHNRLHVRLLEVKEPSSRPVFFDDGFTRKLTFKEHPYREAVKALLADNDRHCVESTE
FT                   QLRHTPHAMTAQGLMSGKERFFDKQDQKRLDEDWLTGFDNRDRLAFLAEQIREVNEQLV
FT                   PAKLALDAAQGDVGQLESQASLLQRIEELQFDDIDRPGAERQLQSLRTQLDTLTRPDSN
FT                   LAVIKAELDQAEALRESLDQQLQRLIEQCVQLKTQFDQAASATRKAYRGAEKGLSDTQR
FT                   ELAQAHFPILSTDDLGDIDELERKHTRELQGQLKTLGEKLGDQKTELAKRMSDALKADT
FT                   GALAEVGRELVDVPRYLERLRVLTEEALPEKLKRFLEYLNRSSDDGVTQLLSYIDHEVS
FT                   MIEERLDDLNSTMQRVDFQPGRYLRLVAKKVIHESLRTLQHAQRQLNSARFIDDEGESH
FT                   YKALQALVGLLKDACEHSRNQGAKALLDPRFRLEFAVSVIDREGNNLIETRTGSQGGSG
FT                   GEKEIIASYVLTASLSYALCPDGSSRPLFGTIVLDEAFSRSSHAVAGRIIAALREFGLH
FT                   AVFITPNKEMRLLRHHTRSAVVVHRRGVESSLVSLSWEALDEHHQQRIRAMHEVAH"
     atgaccttgc tgtgcgccaa tccgcgctac aacctggcat ccacgggcgg gcatgaaagc        60
     gaccgcgatc tggtgtccta tgtgcgcggc gtcaccggcc ccggggacgg aggtgtagag       120
     caatctcata tcgcgcgcca gggtaagact gtcaccgcca ttgccgccac gctcgagcgt       180
     gacggtgcgc aggttcgact gggcgctgtg ctctggttcg agggcaccag ctcctcggcg       240
     tccgatctga aaaaactttg gctgttaagc gagtcccccg agcagacgct ggagcactgg       300
     ctcagccagc atcacgcagg cggcatgcgg gctctgcgtc agatggagaa ggatgggatg       360
     gggatctggc cgtatcccag caagaaagcc ttcctggcca ggctgaggga ttacttcgag       420
     gtcggtgaaa acgctttcac cttgctcaac cgcgctgccg gcctgaagca gctcaacagt       480
     attgatgaga tctttcgaga gctggtactg gatgaccgct ccgccttcga gcgggctgcc       540
     gaggtcgcca gcagcttcga tgatctaact gacatccacc gagaactgga aaccgctaga       600
     aagcagcagc gctcgttgca acctgtcgcc gatggctggg aacgttatag ggccttgcaa       660
     gaacagttgc aggataaaca agcgctcgaa ggcatcctcc cggtctggtt cgccgagcag       720
     gggtatcgtc tgtggttggc tgaaaccaac aggcttgaga aggagcacaa acaggccgaa       780
     ctggatcagg cgcaatgcag gagtcagctt gagatccaga agggcgtggt cgatcaacat       840
     cgtcagcgct acctgcgagt agggggcgca gggatagatc aattacgcgg gcgcattgct       900
     gattgggtca gggagtgcga taagcggcgc ctgaaagccg agcaatacca acgcttggcc       960
     aaggggcttg gactcgcgga tgagttatcg gccgctgcgc tcgaagaaaa tcagcagcag      1020
     atcgcggcac gcctggaaat actggcccag caaactacag acgcgcgcca gaaggcgttc      1080
     gatgcaggtc tcgtccagca ggaactcaat ggccgcctgc agagcttaca gcaggagcgt      1140
     gctgaggttg agagacggcc aggctcgaac ctgcccgggc attttcatgc ttttcgaggt      1200
     gatctggcgc aggagcttgg cgtcgatgag tcggccctgc ctttcgttgc cgagctggtg      1260
     caggtcaagc ccgaggagct ggcctggcgg ggtgccatcg agcgggcaat cggtagccac      1320
     cggctccgga tcttggtgcc gcagggctca tcccaggccg cactgcgttg ggtgaaccaa      1380
     cggcacaacc gcttgcatgt gcgcttgttg gaggtaaaag agccgtcgtc gcgccccgtt      1440
     ttcttcgacg atggctttac ccgcaagctg accttcaagg agcatccgta ccgagaagcc      1500
     gtaaaggcac tactggcgga caatgaccgc cactgcgtcg aaagcacgga gcaattgcgt      1560
     catacccctc acgccatgac ggcccaaggg ctgatgtcgg gtaaagaacg cttcttcgac      1620
     aagcaggacc agaagcgcct ggatgaagac tggctgaccg gcttcgataa ccgcgaccgt      1680
     ctggccttct tggctgagca gattcgcgag gtcaatgaac agctcgtgcc cgccaagctg      1740
     gccctggatg ctgcccaggg cgatgtcggt caattggaga gtcaagcttc gctgctgcaa      1800
     cgcatcgaag agctgcagtt cgacgatatt gatcggccgg gcgccgagcg tcagctgcag      1860
     tcgctgcgta ctcagctgga caccctgacg cgtcccgatt ctaaccttgc cgtgatcaaa      1920
     gccgagctgg atcaagccga ggccctgcgg gagtctctgg accaacagct gcaacgactg      1980
     attgagcagt gtgtgcagtt gaaaactcaa tttgaccaag ccgcatctgc tacccgtaag      2040
     gcctatcgcg gcgccgaaaa ggggctgagc gatacacagc gtgaactggc gcaagcgcat      2100
     ttcccgatcc tgagcacgga tgacctcggc gatattgacg agctggaacg caagcatacg      2160
     cgtgagcttc aagggcaact caaaacgctc ggcgagaaac tgggcgacca gaaaacagag      2220
     cttgccaaac gtatgtccga cgccctgaaa gcagacaccg gggcgcttgc agaggtcggg      2280
     cgagaactgg tggatgtacc caggtatctg gagcgtctcc gtgtgctgac cgaggaagcc      2340
     ctgcccgaga aactcaagcg cttcctggaa tacctcaatc gctcctcgga tgacggtgtc      2400
     acccagctgc tcagctatat cgaccatgag gtctcgatga tcgaggagcg cctggatgac      2460
     ctgaacagta cgatgcagcg tgtcgacttt cagcccggac gctatctgcg cctggtggcg      2520
     aaaaaggtca ttcatgaaag cctgcgcacc ttgcaacacg ctcagcgcca actgaactcg      2580
     gcgcgcttca tcgatgatga aggcgagagc cattacaagg cattgcaggc gctcgttggc      2640
     ctgctcaagg atgcctgcga acacagcagg aatcaggggg ccaaggcact gctggatccg      2700
     cgcttccgcc tggagttcgc ggtatcggtg atcgatcggg aaggcaataa tctcatcgaa      2760
     acccggacag gttctcaggg cggtagcggt ggcgagaagg agatcatcgc ctcctatgta      2820
     ctgaccgctt ccctgagcta tgcgctctgt cccgatggca gcagccggcc gttgttcggc      2880
     accatcgtgc tcgacgaggc gttctcgcgc agctcccatg cggtggccgg tcggatcatc      2940
     gcagcgctga gggagttcgg cctgcacgct gtcttcatca cccccaacaa ggaaatgcgc      3000
     ctgttgcgcc accatacgcg ttcggcagtc gtcgttcatc ggcgcggcgt ggaatccagt      3060
     ctggtttccc tgagctggga agcgttggat gagcatcatc aacagcgcat cagggccatg      3120
     catgaagtcg cccactga                                                    3138
//

If you have problems or comments...

PBIL Back to PBIL home page