(data stored in ACNUC7421 zone)

EMBL: CP000438.PE265

CP000438.PE265       Location/Qualifiers
FT   CDS_pept        297222..298367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03285"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15669"
FT                   /db_xref="InterPro:IPR014544"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="InterPro:IPR024537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZM47"
FT                   /protein_id="ABJ15669.1"
FT                   /translation="MKSPTDIGRNLARQWQRSSVRLERLLNPGSWPQSLNIGKPSARLF
FT                   TDNIQAVLRHVENWRSVNVGKVDWEPVSYRAGLAPISLPMRWHLRSPSEWIAASDDPRV
FT                   SQEYAQLEYLVEQVDSAFHTLLVAQRSLWLTRTPEEVVATAQLATQLAPGCAQGRPLRL
FT                   LAEHGVDTKFFERNATLLTKLLDERFEGAASEQGLTTFLDAFEESSHWVLVVPLQPGLL
FT                   PFKRLRLTTSELAETPLPGSRLLVVENEQCVHLLPETLPDTLAVLGAGLDLHWLASAHL
FT                   AGKQIGYWGDMDTWGLLMLARARLHQPAVEALLMEQELFEQHSQGNTVVEPAKALESAP
FT                   PGLLADEADFYRYLLVQERGRLEQEYLPKAQVELAIRKWAR"
     atgaagtcgc ccactgacat cggccgtaac ctggccaggc aatggcagcg ctccagcgtg        60
     cgcttggagc gcttgctcaa tcccggtagc tggccgcaaa gcctcaacat cggtaagcct       120
     tcggcacgtc tattcactga caacatccag gcggtgctcc ggcatgtgga gaactggcgg       180
     agcgtgaacg tgggtaaggt cgactgggaa cctgtcagct accgagcagg tctggccccc       240
     atttccttgc cgatgcgttg gcatttgcgt agcccctccg aatggattgc cgcgagcgat       300
     gatccaaggg tcagccagga atacgctcaa ctcgagtatt tggtcgagca ggtagacagt       360
     gcctttcata cgctgctggt ggcacaacgg agcttatggt tgacgaggac gcctgaagaa       420
     gtcgtcgcca cggcgcaact cgctactcaa ttagctccgg gctgcgctca aggccgccca       480
     ttgcgtctgc ttgcagagca cggagtggac accaagtttt ttgagcgaaa cgctacctta       540
     ctgacgaagc tcctcgatga gcgcttcgaa ggtgccgcgt cggagcaagg cctgacgacc       600
     tttctggatg cctttgaaga aagcagtcat tgggttctag tcgttcctct tcagcctggg       660
     ctgctgccct tcaagcggct caggctgaca acttcggaac tggccgaaac cccacttcct       720
     ggttcgcgat tgctcgtagt ggaaaatgag caatgtgttc acctgctacc cgaaacgttg       780
     ccggacacct tagcggtgct gggggcagga ctcgatttgc attggttggc gtctgcgcat       840
     ctggccggga aacagatcgg ttactggggc gacatggata cctggggctt gctgatgctg       900
     gcgcgagcga gactccatca acctgcagtc gaagcactcc taatggagca ggagctgttt       960
     gaacagcact cacaggggaa tacagtcgtc gagccggcta aagctctgga atcggctccc      1020
     cctggtttgc tggctgacga ggctgatttc tatcggtatc tgttggtgca agagcggggg      1080
     cgtcttgagc aggagtatct tccaaaggct caggtggagt tggccataag aaagtgggcc      1140
     agatga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page