(data stored in ACNUC7421 zone)

EMBL: CP000438.PE266

CP000438.PE266       Location/Qualifiers
FT   CDS_pept        298567..298875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15215"
FT                   /db_xref="GOA:A0A0H2Z7I3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Z7I3"
FT                   /protein_id="ABJ15215.1"
FT                   /translation="MSKQRRTFSAEFKREAAALVLDQGYSHIDACRSLGVVDSALRRWV
FT                   KQLEAERQGVTPKSKALTPEQQKIQELEARINRLEREKAILKKATALLMSDELDRTR"
     atgagcaagc aacgacgtac gttttccgcc gagttcaaac gagaggccgc ggccctggtg        60
     ttggaccaag gctacagcca tatcgacgcc tgccgttcgc tgggggtggt ggattcggcc       120
     ttgcgccgtt gggtgaagca gctcgaggcg gagcgccagg gtgtgacccc gaagagcaag       180
     gcgttgacgc ctgagcagca aaagatccag gagctggaag cccggatcaa ccggttggag       240
     cgggagaaag cgatattaaa aaaggctacc gctctcttga tgtcggacga actcgatcgt       300
     acgcgctga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page