(data stored in ACNUC7421 zone)

EMBL: CP000438.PE267

CP000438.PE267       Location/Qualifiers
FT   CDS_pept        298872..299717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15216"
FT                   /db_xref="GOA:A0A0H2ZKV6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV6"
FT                   /protein_id="ABJ15216.1"
FT                   /translation="MIDQLSEQESVEVVCSAFDVARSCYYVHRLRRRRVDARRVALRSQ
FT                   VNQLFSQSRGSAGSRSILGMLREEGVTIGRFRVRRLMRELGLVSKQPGSHAYKQATVER
FT                   PDIPNRLNREFATEHPNQVWCGDITYVWAQGRWHYLAAVLDLLIGWAFSAKPDAELVIK
FT                   ALDMAYEQRGRPQQVLFHSVQGSQYASRLFRQRLWRYRMQQSMSRRGNCWDNSPMERLF
FT                   RSLKSEWVPSTGYLTAQEAQRDISHYLMHRYNWIRPHQFNDGLPPAVAEEKLNPLSGMG
FT                   "
     ctgatagacc agttgagtga gcaggagtcg gtggaagtgg tctgttcagc tttcgatgtg        60
     gcgcggtctt gctactacgt ccaccgtctt cgacggcggc gtgtcgatgc tcgccgcgtg       120
     gcgctacgca gccaagtcaa ccagttgttc agccagagtc ggggctcggc cggcagccgc       180
     agcattctgg gcatgctgcg cgaagagggc gtgaccatcg gccgtttccg agtgcgtcgg       240
     ttgatgcgtg agctgggcct ggtcagcaag caaccgggct cgcacgccta caaacaggcc       300
     acggttgagc ggccggatat cccgaatcgg ctgaaccgcg aattcgcgac cgagcatccc       360
     aatcaggtgt ggtgtggcga catcacctac gtctgggcgc aaggccgttg gcactacctg       420
     gccgcggtgc tggatctgct gatcggctgg gcgttctcgg ccaagccgga tgccgaactg       480
     gtgatcaagg ccctggacat ggcctacgaa cagcgcggca ggccacagca ggtgctgttc       540
     cattcagtcc agggcagcca gtacgccagc cgcctgtttc ggcaacggct ctggcgctat       600
     cggatgcagc agagcatgag ccgtcggggg aattgctggg ataactcgcc gatggagcgc       660
     ctgttccgca gtctgaagtc ggagtgggtc ccgtcaacgg gttacctgac ggcgcaggag       720
     gcccaacggg acatcagtca ttacttgatg caccgctaca actggatcag gccgcatcaa       780
     ttcaacgacg ggttaccacc tgcggtggcc gaagaaaaac tcaacccact gtccgggatg       840
     ggttga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page