(data stored in ACNUC7421 zone)

EMBL: CP000438.PE268

CP000438.PE268       Location/Qualifiers
FT   CDS_pept        300333..301931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15217"
FT                   /db_xref="GOA:A0A0H2ZK75"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK75"
FT                   /protein_id="ABJ15217.1"
FT                   /translation="MACSHKKPGFLVPALIETEHLSNMSFLRDFRRVVARAAFRLLADR
FT                   LPKPRSTKESLHILVPRWDAKLGDSIVSSFFFREARRLNARVTVLTVVELAQAHTQDFG
FT                   VDQVVITNANPGVLELRRLAQQLGQVDVVVHLVGRIQPAEILFLRLLRPTRVYSLDDRL
FT                   RCVNRKFGETTAGLDMAERYRRVLMDLGASMVDRKYIVPLPDTMPNPTLAPKILLNPYA
FT                   SRPDKCLAFDRSVSLLHAIADAYPTRSVGILCSPATQEDALRMEVAVARSNVHVVHGLA
FT                   SPKDVAGYIRCAQVVVSVDTAIVHMAVGLETRLVAIYPDVDGQANPWLPPPSPLTRVVY
FT                   SQQHPGQIRRTGKKDMNAFSLEALLDNLHELLATTPETEQLHSIRARKVPGLGAANGTL
FT                   ARQLPLISQDFPEVADCHPGTINLELECPLEVTQPDHRTAPLAWTPSGRTTEVFDLVRI
FT                   ELEFGPLPTRVPAWLYVAHGSPHRCTPTVHEVIARQLNLSEVRECQVHLRASAVTLARP
FT                   DQQTASISRSLSPSQ"
     gtggcttgca gccacaagaa gccaggcttt ctcgtcccag ccctcataga aaccgagcat        60
     ctgagcaaca tgtcattcct acgggatttt cgccgagtag tcgcgcgcgc ggcatttcgt       120
     cttctggcag acaggctgcc aaagcccaga agcacgaaag aaagcctgca cattcttgtc       180
     ccccgttggg atgccaaatt gggcgactcg atcgtttcgt ctttcttctt tcgtgaggct       240
     cgcagactca atgcccgggt gaccgtgctg acggtcgtag agcttgccca ggcgcacacg       300
     caggactttg gtgtggatca ggtcgtgatc acgaacgcca atcctggagt actcgaactt       360
     cgccgcttgg cgcagcagct tggacaggtc gatgtcgtgg tgcatctggt aggaaggatc       420
     cagcctgcgg agatcctgtt tttgcgactg ctgcgtccga cccgcgtgta ctcactcgat       480
     gaccgtttac gctgcgtcaa tcgcaagttc ggtgaaacaa ctgctggtct cgacatggcc       540
     gagcgctacc gacgtgtact catggacttg ggtgcaagta tggtcgatag gaagtacatc       600
     gtcccccttc ctgacacgat gccgaacccc accctcgccc cgaaaatcct actcaacccc       660
     tacgccagcc gcccagacaa atgcttggcc ttcgaccgat ccgtgagctt gctacacgcc       720
     atcgccgatg cttatccaac ccggtctgtc ggcatcctgt gcagccccgc gacccaagag       780
     gatgcgctgc gcatggaagt cgcggtggct cgaagcaacg tgcacgtcgt ccacggactg       840
     gcatccccca aggatgtcgc cgggtacatc cgctgcgctc aggtcgtggt cagtgtcgac       900
     acggccatcg tacacatggc ggtcggccta gaaacaaggc tggtggcaat ctacccagac       960
     gtagatggac aagccaaccc gtggctgccc ccaccctctc cgttgacccg tgtcgtctat      1020
     agccagcaac accctggcca aattcggcgc accggcaaaa aggacatgaa tgcattctcg      1080
     ctcgaggctc tgttggacaa ccttcacgag ttgttggcta ctacacccga aactgaacaa      1140
     ctccattcga tcagagcgcg gaaagtgcct ggcctgggtg ccgcgaatgg aaccctcgct      1200
     cgacagttgc ccctgatcag ccaggacttc cccgaggtag ccgactgtca ccccgggacc      1260
     ataaatttgg agctcgaatg tcctctagaa gtgacgcagc ccgaccatcg caccgctccg      1320
     ctcgcctgga ccccgagcgg acggacgact gaagtattcg acttggtgcg aattgagctc      1380
     gagttcggcc cgttaccaac gcgagtgccc gcatggttgt acgttgccca cggatcccct      1440
     caccgctgca caccgactgt tcatgaggtg atcgcccggc agttaaacct gagcgaggtc      1500
     cgtgagtgcc aggttcatct acgcgcaagc gccgtaacac tggcacgccc agatcaacaa      1560
     acggcttcta tcagccgctc gctttccccc agccaatag                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page