(data stored in ACNUC7421 zone)

EMBL: CP000438.PE269

CP000438.PE269       Location/Qualifiers
FT   CDS_pept        complement(302683..303804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15218"
FT                   /db_xref="InterPro:IPR028944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJQ3"
FT                   /protein_id="ABJ15218.1"
FT                   /translation="MTPGKSLPWSEVLTRPVDVQLTMFRQASAQPCADDVKTGFRAFSA
FT                   DLFARGLISMAEYVSIFGGTVLHCLTPAESGLFRDMDTGADASALAGVYSRAKYGSVGD
FT                   IQYLARQLIDYLCGELDRPDSQWSCLFRNAKACGDNVVMMTTGWRNVPSTANVLYEIVV
FT                   EEVNVKLAHMALPTIINVKLPRIAPPCEDYANLSTEERERVNLVQDHVIPAENFYRWSG
FT                   VHVIFGDDVLVTGSTADKVLYESMRSGAKSFRAIYPVAIDPRVALGDASVEDRLNSVVV
FT                   EQRLDDTVAELLSARDYQPILRTLRLLFGEGNRESLAAFLPKVPAPTWLRLYKSALGNE
FT                   FLGQPQCAPSLVLLREYLTNAGLLSTNGRAIHP"
     atgacccccg gaaaatcact gccctggtct gaggtgctta cgaggccggt tgatgtccaa        60
     ttgacgatgt ttcgtcaggc ttccgctcag ccctgtgctg atgatgtgaa gacaggtttc       120
     cgtgcgttct ctgccgacct gttcgcacgc ggactgatca gcatggccga gtatgtttcg       180
     attttcggcg gtactgtcct gcactgcctg acacccgccg agtcggggct gttccgagac       240
     atggatacgg gtgccgatgc ctcggcgctg gccggggtct acagccgtgc caaatacggc       300
     agtgtgggtg acatccaata tctcgctcga caactcatcg attacctctg cggcgagctg       360
     gataggccgg actcgcagtg gtcgtgcctt ttccggaatg ccaaggcctg tggtgacaat       420
     gtggtgatga tgaccaccgg ttggcgcaac gtgccgtcaa cggcgaacgt gctctatgag       480
     atcgtggtcg aagaggtcaa cgtcaaacta gcgcatatgg cgttgcccac catcatcaac       540
     gtcaagctgc ctagaattgc gccaccttgt gaggactacg caaacctcag caccgaggag       600
     cgcgagcgcg tcaatctggt ccaggatcac gtcattccgg ctgaaaattt ctatcgttgg       660
     agcggtgtgc atgtgatctt cggcgacgat gtgttggtta ccggatctac tgccgacaaa       720
     gtgctttatg agtccatgcg tagcggtgca aagtcgttcc gcgcaatcta tccggtggcg       780
     atcgatcccc gagtggccct gggcgatgcc tcggtcgagg atcggctgaa tagtgtggtg       840
     gtcgagcaac ggctggacga taccgttgcg gagctgttgt ctgcgcggga ctaccaacct       900
     atcttgcgca ccctgcgcct gctgttcggg gagggcaacc gagaatcgct cgccgccttc       960
     ctgccgaagg tgcctgcgcc gacctggctg cgcctgtaca agtctgcctt gggtaacgag      1020
     tttctaggtc agccgcaatg tgctccttcc ttggtgttgc tgagggagta cctgacaaat      1080
     gccgggttgc taagtaccaa tggcagggcg attcacccgt ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page