(data stored in ACNUC7421 zone)

EMBL: CP000438.PE270

CP000438.PE270       Location/Qualifiers
FT   CDS_pept        complement(303810..304676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15219"
FT                   /db_xref="GOA:A0A0H2ZKP4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP4"
FT                   /protein_id="ABJ15219.1"
FT                   /translation="MIDSHSHTFYSKHATGTVDELVRASIAAGVTILTLTDHAPFPVDT
FT                   DNRLLASELDRYFADIERARNSYQEQITILCGLELDYMPGTDAFNRELLTCYPMDFVIG
FT                   SIHYVEVPDETMVKVWELPRLAGQAFLDRYFANLEGLLDSGLFDAVGHADTLLRGVPED
FT                   IFLRRFEPLLAPLARSGIAFELNASGLRKSSLDPATGREVQGFWSYPSRELVAQLIAHE
FT                   VPFTVGSDTHDPSDAGAGIAELLTALQPLGLQRISYYERRRRIDVALDTLALPGAPATL
FT                   TEGLERP"
     atgatcgact cacacagcca caccttttat tcgaagcatg cgaccggcac cgtcgatgaa        60
     ttggttcgcg cctcgatcgc cgccggcgtg accatcctaa ccctcaccga ccacgcgccg       120
     ttccccgtgg ataccgacaa tcgtctgctc gcgtccgaac ttgatcgcta tttcgccgac       180
     atcgagcggg cgcggaatag ctaccaggag cagatcacca tcctgtgcgg cctggagctc       240
     gactacatgc caggcaccga cgccttcaat cgcgagctgc ttacttgtta cccgatggac       300
     ttcgtaatcg gctcaattca ttacgtggaa gttccagacg aaaccatggt gaaggtctgg       360
     gagctgccgc gcctggccgg acaggcgttc ctggaccgct acttcgcaaa tctcgaaggt       420
     ctgctagaca gcggactgtt tgatgccgta gggcacgccg acaccttgct gcgtggcgtg       480
     ccggaagaca tcttcctgcg ccgtttcgaa cctttgctgg cgccgctcgc ccgaagcggt       540
     attgcattcg agctcaatgc ctcaggtctt cgaaagtcga gtctggatcc tgcaacgggg       600
     agggaggttc agggcttttg gtcttatccg tctcgagagt tggtggctca gcttatcgcg       660
     cacgaagtgc ccttcacggt tgggtccgat acccatgacc cgagtgacgc cggtgcaggc       720
     attgccgagc tgctcacggc cctgcagcct ttggggctgc agcgcattag ttactacgag       780
     aggcgccgac gaattgatgt cgccctcgac accctggcgc taccaggtgc accagcaact       840
     ttgacagaag gacttgaacg gccttga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page