(data stored in ACNUC7421 zone)

EMBL: CP000438.PE271

CP000438.PE271       Location/Qualifiers
FT   CDS_pept        complement(304673..305599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15220"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK0"
FT                   /protein_id="ABJ15220.1"
FT                   /translation="MELSTLARENLARLINAPEVKRISISGEGEPLNNVKVFHEILGLS
FT                   EGGKCFEFITSGFYPHDKMADFYDTTNRIVLGNGDVCNIRLSADSHHIEQVKWRAHGFS
FT                   LDYLRSRCPSGLSFSFRSIDTDRDFTREYLKSELARWGVEATIEPRSVLEDVLVAGGEC
FT                   FGIDYKNLVHPAPGTAPGYLDMLGYIEAIESKVNKRFTFGSLNKPPQANGLDVTVKPNG
FT                   DVYLYGIENQRLGNIHFDRVDWQRLVAHVRETPLTRALYTQPLTELLARLEKTDLLRSI
FT                   IAKANNPYWLVKELAGHAGLLEQWEAA"
     atggagctat caacgttggc gcgggaaaac ctcgctaggt tgatcaatgc cccggaggtc        60
     aagcgcatct ccatcagcgg cgaaggcgag ccgctcaaca acgtcaaagt gttccacgag       120
     atcctcgggt tgtccgaagg tggcaagtgc ttcgagttca tcactagtgg gttctaccca       180
     cacgacaaga tggcggactt ctacgacacc accaaccgca tcgtcttggg caatggcgac       240
     gtctgcaaca tccgcctgag tgccgacagt caccacattg agcaagtcaa atggcgggcc       300
     catggcttca gtctggacta cctgcggagc cggtgcccgt ccggtctgag tttctcgttc       360
     cgctcgatcg acacggatcg cgacttcact cgcgagtatc tgaagtccga actggcccgc       420
     tggggggttg aggcaaccat cgagccgcga agtgtgctgg aagacgtgct ggtcgcgggc       480
     ggtgagtgct tcggcatcga ctacaagaac ctggtacatc ccgctcctgg aaccgcaccg       540
     ggttatctgg acatgctggg ctacatcgag gcgatcgagt ctaaggtcaa caaacgcttc       600
     accttcggaa gcctgaacaa accgccgcag gccaacggtt tggatgtcac ggtgaagccg       660
     aacggcgacg tatacctata tggcatcgag aaccagcgcc tgggcaacat tcactttgac       720
     cgggtcgatt ggcaacggct agttgcgcac gtgcgggaga caccattgac ccgagcactc       780
     tatacgcaac ccttgactga gttgctggcg cgcctggaga agacggacct gctgcgttca       840
     atcattgcca aggcgaacaa cccctactgg ctggtgaagg agctggcagg tcatgccggg       900
     ttgctcgaac agtgggaggc tgcatga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page