(data stored in ACNUC7421 zone)

EMBL: CP000438.PE272

CP000438.PE272       Location/Qualifiers
FT   CDS_pept        complement(305950..306903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15221"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW0"
FT                   /protein_id="ABJ15221.1"
FT                   /translation="MAELNVIFDVPEAIAEGLKNGVYERIGGVIRRVADKQIVMWLQEG
FT                   VLLERDTAEQLLKQGAEHVQLLRQQAEQLQMLGVQQQLIMGLEVANLAVSVAGFALTLY
FT                   KLQGIENQLRHMDGKLDDIRQGVEWLDVRQMISRLAPLHAALQHVREAGLYRNAAMMQQ
FT                   QLGIANSQLAESQSYFGGLLQHVSERSFEYLQPGEFAAAYRGWVMSAQGRLQVLARLGE
FT                   MDLAAHLANEFKERHAGFGQRLQQSLKNPALRLMAGQQGETNHARLLSIAEQAVGAHEI
FT                   IRGNVMQLEFMRDEQLDLPILNSPAGYQGLAFCRVG"
     atggctgagc taaatgtgat cttcgatgtg ccggaggcga ttgccgaggg gctgaaaaac        60
     ggtgtttatg aacgtatcgg tggcgtcatc cgcagggtgg ctgacaagca gatcgtgatg       120
     tggctgcagg aaggtgtgct gctggaacgc gatactgccg aacagttgct caaacagggg       180
     gccgagcatg tccagttgct gcgtcagcag gctgagcaac tgcaaatgct cggtgtgcaa       240
     cagcagttga tcatggggct ggaggtggcc aatctggcgg tcagtgtcgc gggctttgcg       300
     ctaacgctgt acaagctgca gggtatcgag aaccagctta gacacatgga tggcaagctc       360
     gacgacatcc ggcagggtgt cgagtggcta gatgtcaggc agatgatcag ccggctggct       420
     cctttacatg cagccctgca gcatgtacgc gaggccgggc tgtatcgtaa tgccgcgatg       480
     atgcagcagc agctcggtat tgctaacagc cagctcgcag agagccaaag ttactttggt       540
     gggctattgc agcatgtgag tgagcgttcg tttgagtatc tgcagcccgg cgagtttgcg       600
     gccgcttacc ggggttgggt gatgtctgcg caggggcggt tgcaggtgct ggctcgtttg       660
     ggggaaatgg atctggctgc gcatctcgcc aatgagttca aggaacgtca tgccgggttc       720
     ggtcagcggc tgcagcaaag cctgaaaaat ccggcgctgc gcctaatggc gggtcagcaa       780
     ggcgaaacca atcatgctcg cttgcttagc attgctgagc aggccgtcgg tgcacacgag       840
     atcatccgcg gtaacgttat gcagctggag ttcatgcgcg atgagcaatt ggatctgcca       900
     attctgaata gtccggccgg gtatcaagga ttggcgttct gccgagtggg ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page