(data stored in ACNUC7421 zone)

EMBL: CP000438.PE273

CP000438.PE273       Location/Qualifiers
FT   CDS_pept        complement(306896..307666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15222"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK79"
FT                   /protein_id="ABJ15222.1"
FT                   /translation="MTSIDISNTRQLLERASNDDLEPLVEYILKANTESLSKQVDFKRS
FT                   HPEHRRYASSILDELRLFGGNSFVNLWRKSGPSYTEVVRDVASKLKVKGAGSMELIELE
FT                   EAMVQSILRQALEKSSGEDRRELEVILREAGLDKTKMTALLNGSALSGLVVPTVARLIL
FT                   YRTSTVIVNSMAQQLLGHGLRSAVVAGGTFAGGRAVAALAGPVGWVIAGIWTAVDLAGP
FT                   AYRVTIPCVLQIAMLRLKARAEAATDFMNGAFDG"
     gtgaccagca tcgatatcag caatacccgc cagcttctgg agcgtgccag caatgatgat        60
     ctggaacctc tggtggagta catcctcaag gccaataccg agtcgctgtc gaagcaagtg       120
     gacttcaagc gcagccaccc ggaacaccgc cgctatgcca gttcgatcct tgatgagctg       180
     cgattgttcg gcgggaacag cttcgtcaac ctgtggcgta agagcgggcc ttcctacacc       240
     gaggtggtcc gggatgttgc cagcaagctt aaggtcaagg gggctggctc aatggaactc       300
     attgaactgg aggaggcgat ggtgcagtcg atcctccgtc aggcgttgga gaagtcgtcg       360
     ggcgaggatc gccgcgagct ggaagtgatt ctgcgcgagg cggggctcga caagaccaag       420
     atgacggctc tgctgaatgg ttcggcactg agtgggctgg tagtgccgac cgtagcacgg       480
     ctaatcctct atcgcacttc gacggtgatc gtgaactcga tggctcagca gctgcttggg       540
     cacgggctgc gcagtgcggt ggttgctggg ggaaccttcg ctggcggtcg tgccgtcgcc       600
     gcgctagccg ggccggtcgg ctgggtgata gccggtatct ggaccgccgt ggatctggcc       660
     ggcccagcct accgggtcac catcccttgc gtgttgcaaa tcgccatgct gcgtctcaag       720
     gctcgtgccg aggccgcgac tgatttcatg aatggagctt tcgatggctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page