(data stored in ACNUC7421 zone)

EMBL: CP000438.PE274

CP000438.PE274       Location/Qualifiers
FT   CDS_pept        complement(307985..308983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15223"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJQ8"
FT                   /protein_id="ABJ15223.1"
FT                   /translation="MAPPRLPQAQCLDAPPSPCRPASRCAGRSSWCASEPGHSTRPEHR
FT                   RLVHRTFKRNRSMSIIHDADLAGVLMSASADDIRLLIDVITDSGKGRISLSSAICRQLT
FT                   AAKEGEVGDYERALVAEELTRFGGNSLMNLFRGGSGVSYVELLSDVASHVGVSKAGTGD
FT                   CAQMEMAIIAKVVEQSIGRMSEEDKETFFESMGASYRPGMGAAALAALITSLSASSTAY
FT                   RLAAVVASATMSSLVGRGVAFAGGAAMGRGLAVLSGPVGWAITGIWTAFELASPAYRVT
FT                   VPCVIQIGHMRQKMLLKEGCPECHASTPAGSKFCSSCGARLASRLPHSIHD"
     atggcgccgc ctcgcctgcc tcaagctcaa tgccttgatg ctccgcccag tccatgccgc        60
     ccagcctcgc gttgcgctgg ccgcagtagc tggtgcgcta gtgagccggg gcactccaca       120
     cgacccgaac atcggcgact agttcatcga acattcaaga ggaatcgcag tatgtcaatc       180
     attcatgacg ccgacctggc tggcgtgctg atgagcgcta gcgctgacga tattaggctg       240
     ctgatcgacg tcatcaccga cagcggtaag gggcggatct cgttgtcctc agcgatttgc       300
     cgccaactga ccgcggcgaa ggagggtgaa gtcggcgact acgagcgcgc attggtcgcc       360
     gaagagctca cgcggtttgg cggcaactcg ctgatgaacc tgttccgggg cggcagcggc       420
     gtgtcttatg tagaactgct gagcgatgtt gcttctcacg tgggtgtctc gaaggccggg       480
     acgggcgatt gcgcgcagat ggaaatggcc atcatcgcca aggtggtcga gcagtcgatt       540
     ggtcgcatga gcgaggaaga caaagaaacc ttctttgagt cgatgggggc cagctaccgg       600
     ccgggaatgg gcgcggctgc cctggcagcg ctgatcacca gcctgagtgc cagctcgact       660
     gcctaccggc ttgccgcggt agtggccagc gcaacgatga gcagcctggt cggccggggc       720
     gtcgcgtttg ccgggggcgc tgccatgggc aggggattgg cggtgctctc agggcccgtc       780
     ggctgggcaa ttaccggcat ctggacggcc ttcgagttgg ccagcccggc ctaccgggtg       840
     acggtgccat gcgtcatcca gattggccac atgcgccaga aaatgctgct caaggagggg       900
     tgccctgaat gccacgcgtc gactcccgct ggcagtaagt tttgtagcag ttgcggcgca       960
     cggcttgcga gtcgcttacc tcattccatt cacgattag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page