(data stored in ACNUC7421 zone)

EMBL: CP000438.PE275

CP000438.PE275       Location/Qualifiers
FT   CDS_pept        309749..311728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15224"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP9"
FT                   /protein_id="ABJ15224.1"
FT                   /translation="MRLKKRHDPMIALEAAQSFTKRELCVPLARWISDFLSRRGLQKPD
FT                   GRPLFAYKTSSEEFRALRQLLQNLPGGQQVSPSYPQAWLLFAAEWWKREYSGGAWRWGP
FT                   LCEAAGQRGLSHEKTRKLVIEGRRQWCLQTAIKNEGKRFIGLVAVNGGLPMRLVESAQG
FT                   GLSGLLRMVTLQAVDYDLHDEQLRQAIEAQAALLPACYQQAPVYELLDNLIKAVLHIRR
FT                   TYALKGTQDPIAKLQEECPQWEELFPIALDSQAAASLIKGLVRVTVSITPQSRRPPFQI
FT                   QRGLRFSSDGSMPVYELSFAMQAQAKRDQVAESLGLAADRLPPHFQLLLRIGEREHLVG
FT                   EALLRDDEYQLIARPLPSIQTVHEAAQLIVSRWGATLHIANLPGGEALSHDEPLIFENT
FT                   YPFARLIAQGDALVKGLSALAVMPARTIVLAEEGETRELHDCLADGQMLMELPAGKTRL
FT                   AYRGQAFIVTISASATHRPEAYWQGNSLEALSVPGLLFRGTPHLRVDQGLGHSSYAPSH
FT                   ELFVRSHSKELPLGEAQAPGLCRLIWRKDGQRLLSTRAVLLPEGASITYVPAASTLEGT
FT                   IRLDNWPDVPVRCENEEIELDSRHDGTNLVLRLKSTSARPATSVPLCMQWPDGEHRLTL
FT                   PFPGYGVTLQRNNLMWLIRVAVRL"
     ttgagattga aaaaaagaca cgatccgatg attgccctag aggcagctca gtcgttcaca        60
     aaaagggaat tatgtgtgcc gcttgcccga tggatctcag attttctatc caggcgtgga       120
     ctgcaaaagc cagatggtcg tccccttttt gcctataaga cctcttcaga agagttcagg       180
     gcactgcgcc agcttttgca gaatcttccc ggaggacagc aagtaagtcc cagctaccct       240
     caggcttggc tactgtttgc cgccgagtgg tggaagcgag aatattcagg tggcgcatgg       300
     cgctgggggc cgctgtgcga ggcggcaggc cagcggggct tgtcacatga gaagactcgc       360
     aagctggtca ttgaagggcg tcgccaatgg tgtctgcaaa ccgccatcaa gaatgaaggc       420
     aaacgtttca tcggcctggt cgcggtgaat ggcggcctgc cgatgcgcct ggtcgagtcg       480
     gcgcagggcg ggctatccgg cctgctgcgc atggtcaccc tacaggcggt ggactacgac       540
     ctgcacgatg agcaactgcg tcaggctatc gaagcccagg ctgctctttt gcccgcatgc       600
     tatcagcaag caccggtcta tgagctgctg gacaacctga tcaaggcggt cctgcatatc       660
     cgcaggacct atgctctgaa gggtacccaa gatccgatcg ccaagctgca ggaagaatgc       720
     cctcagtggg aagagctctt tcccatcgca ctcgacagtc aggcagcagc cagcctcatc       780
     aagggcctgg tccgggtcac agtcagcatc acgccccagt ccaggcgccc ccctttccag       840
     attcagcgtg gcctgcgctt cagctccgac ggctccatgc ccgtctacga gctgtccttt       900
     gccatgcagg cacaagccaa gcgagatcaa gttgccgagt cactggggtt ggctgctgat       960
     cgactgccgc cgcacttcca actgctgctg cgcatcggcg agcgagagca cctggtcggc      1020
     gaagcattgc tcagggatga cgagtatcag cttatcgcca gaccgctgcc ctccattcaa      1080
     actgtgcacg aagctgcgca gctgatagtc agtcgctggg gcgccacttt gcacatcgcc      1140
     aacctgcccg gcggcgaagc gttaagccac gacgaaccgt tgatcttcga aaatacttat      1200
     ccctttgctc gtctgattgc gcaaggcgat gctctggtga aggggctgtc cgcactggcg      1260
     gtcatgccgg caagaaccat cgtattggct gaggaaggcg agacccgtga acttcacgac      1320
     tgccttgctg atgggcagat gctgatggag cttccggccg gcaaaacgag gctcgcctat      1380
     cgcggacaag cgttcattgt caccatcagc gccagtgcta cgcaccgccc ggaagcctat      1440
     tggcaaggta atagcctaga ggcgctctct gtgccgggcc tgctgttccg cggtacgcca      1500
     caccttcgag tcgatcaggg gctggggcat tccagttacg cgccgtccca tgaacttttt      1560
     gttcgcagtc attccaagga gctcccactc ggtgaggcac aggcaccagg actatgccga      1620
     ctgatctggc gcaaggatgg ccagcgccta ctgagcaccc gcgccgtact ccttccggag      1680
     ggagcttcca ttacctatgt tccagcggca agcaccctcg aaggaaccat ccggctcgac      1740
     aactggcccg acgtaccagt ccgttgtgag aacgaagaga tcgagctgga cagccgtcat      1800
     gatgggacaa acctggtcct caggctgaaa agcacgagcg ctcggcctgc aacttcagtt      1860
     ccgctctgca tgcagtggcc cgacggcgaa cataggctca cgctgccttt ccccggttat      1920
     ggcgtcacgc tgcagcgcaa caatctgatg tggttgattc gcgtcgctgt cagactctga      1980
//

If you have problems or comments...

PBIL Back to PBIL home page