(data stored in ACNUC7421 zone)

EMBL: CP000438.PE276

CP000438.PE276       Location/Qualifiers
FT   CDS_pept        complement(311665..312174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15225"
FT                   /db_xref="GOA:A0A0H2ZKK3"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR022000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK3"
FT                   /protein_id="ABJ15225.1"
FT                   /translation="MGKIVARKETGNLFFDFRYLGKRCREQTALPDTPTNRKKLEKILE
FT                   RIEAEITLGTFDYNEYFPQSGRADELSRLKAGISRLKVPQFKDFAQLWFDEKKMEWRDS
FT                   HTNTVRLTLEKYLLPTFGKQEVSAITKADILAFRSALGKVPGQKGQSLTATRINHIRLL
FT                   RCSVTP"
     gtgggtaaga ttgttgcccg taaagagacc ggaaatctgt tcttcgattt ccgttacctg        60
     ggcaagcgct gccgtgagca gacggccctt cccgacaccc cgaccaaccg gaagaaactg       120
     gagaagatcc tcgagcgcat cgaggccgaa atcactctcg gcaccttcga ttacaacgag       180
     tatttcccgc agagcggccg tgccgacgag ctaagccggc tcaaagctgg catctcgaga       240
     ctgaaggtgc cgcaattcaa agacttcgcc caactctggt tcgacgaaaa aaagatggaa       300
     tggcgcgata gccacaccaa taccgtacgc ctcacgctcg agaaatatct gctgccaacg       360
     tttggcaaac aagaggtcag cgccatcacc aaggcagaca tcctggcttt ccgctcggca       420
     ctcggcaaag ttcccgggca gaaaggtcag agtctgacag cgacgcgaat caaccacatc       480
     agattgttgc gctgcagcgt gacgccataa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page