(data stored in ACNUC7421 zone)

EMBL: CP000438.PE277

CP000438.PE277       Location/Qualifiers
FT   CDS_pept        complement(312167..312499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15226"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW6"
FT                   /protein_id="ABJ15226.1"
FT                   /translation="MSQKQLESLIRLINITFDPNSSYLIHLNPERVMNEIYLTTDELSQ
FT                   RIKYDARTIRNCLKDSVLLEGIHYFRPFGGRKILFIWEAVERDMVKFSRENGFGIPMAN
FT                   GGICRG"
     ttgagtcaaa aacagcttga aagtctcata cgcctcatta atatcacttt cgatccaaac        60
     agctcatatt tgattcattt gaatccggag agagtgatga acgaaatcta tctgacgacc       120
     gacgagctgt ctcagcgcat caaatacgat gcgcggacca tccgtaattg cctgaaggac       180
     tctgtgctgc tggaaggtat ccattacttc cgcccctttg gcggtcgaaa aatcctgttc       240
     atctgggaag ctgtagaacg ggacatggtc aagttctcgc gtgaaaacgg ctttggcatc       300
     ccgatggcga atggggggat ctgccgtggg taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page