(data stored in ACNUC7421 zone)

EMBL: CP000438.PE278

CP000438.PE278       Location/Qualifiers
FT   CDS_pept        complement(313222..313638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK82"
FT                   /protein_id="ABJ15227.1"
FT                   /translation="MSSGSTSTTPRAWLSGSVVTGKCCLLVIRKGQRPGVPFPAPCASG
FT                   VAVTGRPPCATGGRGRTRPPTGVGEDTKDSCGKGIADETPRRHHGGPAARKAGRATGRS
FT                   ERGHSRGTRPAELMPIPRSPVVVALGAFEISNES"
     gtgagcagcg ggtctacctc gactaccccg cgtgcctggt tgtctggttc ggttgtaacc        60
     ggaaagtgtt gcctgctggt tattcgaaag ggccagcgcc ccggtgttcc atttcctgcg       120
     ccctgtgcca gcggcgtcgc cgttaccggc cggccaccgt gcgcaacggg cggacgcgga       180
     cgaacgcgac cgccgacagg cgtcggggag gatacgaaag actcgtgcgg gaaagggatt       240
     gcggacgaaa cgccacgccg gcaccacggc ggcccggcag cgcgaaaggc cggacgagcg       300
     acgggcaggt cagaaagagg tcattccagg ggcacgcggc cggctgaact gatgccaatt       360
     ccccggtctc ctgttgttgt ggctttgggg gcgtttgaaa tctcaaacga atcctag          417
//

If you have problems or comments...

PBIL Back to PBIL home page