(data stored in ACNUC7421 zone)

EMBL: CP000438.PE28

CP000438.PE28        Location/Qualifiers
FT   CDS_pept        29917..30519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIX3"
FT                   /protein_id="ABJ14984.1"
FT                   /translation="MKRWLGVALGCSGLAIALACAGVLLAPADMAASSSSPPPARTVAA
FT                   LPAVDDRPPPLAPVRSQAVAPAYEAEPPAAELDREQAIQFMQMLRDEGDPRSPPLGGLQ
FT                   PRQGATAQELADPKQYQAFEERQTRELVQAYTSGVQQIPEIRARIEAAEQGGERSAEEI
FT                   DEARAALGQLEMMRDKLQRESPQLLPGDSAPTSPAAP"
     gtgaagcgct ggctcggcgt tgccctcggc tgcagcgggc tggcgatcgc cctggcctgc        60
     gccggcgtgt tgctggcgcc cgccgatatg gccgcttcct cgtcttctcc gccgccagcc       120
     aggacggttg cggcgctgcc cgcggtcgac gaccgtccgc cgccgctggc gccggtacga       180
     tcgcaagcgg tggcaccggc gtacgaggcg gagccgccgg cggcggaact ggatcgcgag       240
     caggcgatcc agttcatgca gatgctgcgc gacgagggcg acccgcgcag cccgccgctc       300
     ggcggcctgc aaccacgcca gggcgcgacg gctcaggagc tggccgatcc gaagcagtac       360
     caggccttcg aggaacgaca gacccgcgaa ctggtacagg cctacaccag cggcgtacag       420
     cagataccgg aaatccgcgc gcggatcgag gcggccgaac agggtggcga gcgcagcgcc       480
     gaggaaatcg acgaggctcg cgccgccctt ggacagttgg agatgatgcg cgacaagctg       540
     cagcgggaat cgccgcaact gctgcccggc gacagcgcac cgacatcgcc ggcggcgccc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page