(data stored in ACNUC7421 zone)

EMBL: CP000438.PE284

CP000438.PE284       Location/Qualifiers
FT   CDS_pept        320329..320736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15233"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJR8"
FT                   /protein_id="ABJ15233.1"
FT                   /translation="MKANRSIACLLLAALPTLASAHAAEKVETLRDQALAEIPGHRGLM
FT                   LTVSFKPGQVSAPHVHPGSVFVYVLEGTVQTQLEGGPVETYTVGQSWYEPANVPHLLAR
FT                   NPDPMKPAKLLVWELLKEGDPILKPLERGAH"
     atgaaggcca atcgatcgat cgcctgcctg ctgctcgccg cgctgccgac gctggccagc        60
     gcccatgctg cggagaaggt ggaaaccttg cgcgaccagg ccctggccga gattcccggc       120
     catcgtgggt tgatgctgac ggtgtcgttc aagcccggcc aggtctccgc gccccatgtg       180
     catcccggct cggtgttcgt ctacgtgctc gaaggcaccg tgcagacgca actggaaggc       240
     ggcccggtgg aaacctacac ggtgggccag agctggtacg agccggcgaa cgtgccgcac       300
     ctgctggcac gcaatcccga tccgatgaag ccggccaagt tgctggtctg ggagttgctc       360
     aaggagggcg acccgatcct caagccactg gagcgcggcg cccactga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page