(data stored in ACNUC7421 zone)

EMBL: CP000438.PE285

CP000438.PE285       Location/Qualifiers
FT   CDS_pept        320770..321054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15234"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR0"
FT                   /protein_id="ABJ15234.1"
FT                   /translation="MSASQVIRIRARNGQSERLGLRLQQLVEPGLEAPGCLEYQVRRDA
FT                   LEPDLWLVCSQWREAQQMFDYLAGGIQQVFAEVLWRSLAASLEVQDDAG"
     atgagcgcca gccaggtcat ccgtattcgc gcgcgcaacg gtcagtcgga acggcttggc        60
     ctgcgcctgc aacaactggt cgaaccgggg ctggaggcgc cgggttgcct ggagtaccag       120
     gtgcgcaggg acgccctcga gccggatctc tggctggtgt gcagccagtg gcgggaagcg       180
     cagcagatgt tcgactacct ggccggcggc atccagcagg tattcgccga agtgctctgg       240
     cgctccctgg cggcgagcct cgaagtgcag gatgacgcag gctag                       285
//

If you have problems or comments...

PBIL Back to PBIL home page