(data stored in ACNUC7421 zone)

EMBL: CP000438.PE288

CP000438.PE288       Location/Qualifiers
FT   CDS_pept        complement(323410..324180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK91"
FT                   /protein_id="ABJ15237.1"
FT                   /translation="MPRPALPAVLCLCCLLLALPARAALDDQQRALQQLQVQACRAVGS
FT                   LLLLRGEGFQEQHAAQLEKDLASLDRALAAAPEGVLLRQGERALVARIREGAAYGPREE
FT                   DLPWRYPQQLSRALRDFLNLVERQVPPPPPGQPLPLWQLPVRVEYLSLQYLARAYLGGL
FT                   EIAREQPRDYLGQDESVLVPLIDRRIALLVAQSANPAGLKKLENRWEYLSQALRDLNSK
FT                   SSALVSASGRPWAPIIVDRHARALSESLMRLSAE"
     atgccccgtc ccgcgcttcc cgctgtcctc tgtctttgct gcctgttgct ggcgctgccg        60
     gcgcgcgccg ccctcgacga ccagcaacgc gccctgcaac aactgcaggt ccaggcctgt       120
     cgcgcggtgg gcagcctgtt gctgctgcgc ggcgagggct tccaggaaca gcacgcggcg       180
     caactggaga aggacctcgc cagcctcgat cgggcgctcg ccgccgcccc cgagggggtg       240
     ctcctgcggc aaggcgaaag ggcgctggtg gcgcgcatcc gtgaaggcgc ggcctacggc       300
     ccccgcgagg aggacctgcc ctggcgctac ccgcagcaac tgagtcgcgc cctgcgtgac       360
     ttcctcaacc tagtggaacg ccaggtgccg ccgcccccgc caggccaacc cctgccgctc       420
     tggcagttgc cggtgcgggt cgagtacctg tccctgcaat acctggcgcg cgcctacctg       480
     ggcgggctgg agattgcccg cgaacagccc cgggactatc tcggccagga cgagagcgtg       540
     ctggtcccgc tgatcgaccg gcgcatcgcc ctgctggtgg cgcaaagcgc caacccggcg       600
     ggactgaaga aactggaaaa ccgctgggag tacctgagcc aggccctgcg cgacctgaac       660
     agcaagagca gcgcgctggt cagcgcttcc ggcaggccct gggcgccgat catcgtcgac       720
     cgccacgcgc gggccctgag cgaaagcctg atgcgcttga gtgcggagtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page