(data stored in ACNUC7421 zone)

EMBL: CP000438.PE290

CP000438.PE290       Location/Qualifiers
FT   CDS_pept        325051..325566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03590"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15239"
FT                   /db_xref="GOA:A0A0H2ZKR7"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR7"
FT                   /protein_id="ABJ15239.1"
FT                   /translation="MKTLVDHLAQYAAYHRDRRNIFSHFIGIPMIVLSIAVLLARPALG
FT                   FGLSPALLLALAAALFYLRLDLRFGAAMTALLALTVWGAAQLAAGTTAAWLGWGVGLFV
FT                   VGWIIQFVGHYYEGRKPAFVDDLSGLIVGPLFVLAELAFLLGLRGDVQREVEERAGPTC
FT                   IREHKRAA"
     atgaaaaccc tagtcgatca ccttgcgcaa tacgccgcct accaccgcga ccggcgcaac        60
     atcttcagcc atttcatcgg cattccgatg atcgtcctct ccatcgccgt gttgctggcg       120
     cggccggcgc tggggttcgg cctgtctccg gcgctgctgc tggcgctcgc cgcggcgctg       180
     ttctacctgc gcctggacct gcgcttcggc gcggccatga cggcgctgct ggcgctgacg       240
     gtgtggggcg ctgcgcaatt ggcggcgggg actaccgcgg cctggctggg ctggggcgtt       300
     ggcctgttcg tggtcggctg gatcatccag ttcgtcggtc attactacga agggcgcaag       360
     ccggccttcg tcgacgatct cagcgggttg atcgtcggtc cgctcttcgt gctggcggaa       420
     ctggcctttc tgctggggct gcgcggcgac gtgcagcgcg aggtcgagga gcgcgccggc       480
     ccgacctgca ttcgcgagca caagcgggcg gcgtga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page