(data stored in ACNUC7421 zone)

EMBL: CP000438.PE292

CP000438.PE292       Location/Qualifiers
FT   CDS_pept        complement(326536..327288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03620"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15241"
FT                   /db_xref="GOA:A0A0H2ZKY0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY0"
FT                   /protein_id="ABJ15241.1"
FT                   /translation="MSVDLHALIPLIALTFLLAGFVKGVVGLGLPTVSVGLLGLAMPPM
FT                   QAAALLIVPSMVTNLWQLACGPRFLGLMKRLAGLLLGVVVGTLLVGAWLGGDAPRQATG
FT                   VLGLALAAYALLGLAAIPLHLPARHEPWAGPLVGLATGALTAVTGVFVIPAVPYLGALR
FT                   LQRDELVQALGLSFSASTLALAVTLGVHGDLLEPQMLGASLLTLVPALGGMLLGQWLRQ
FT                   RISATLFRRCFFVGLLLLGADLAWRGFH"
     atgtccgtcg acctccacgc cctgatcccg ctgatcgccc tcaccttcct tctcgccggc        60
     ttcgtcaagg gcgtggtcgg cctgggcctg ccgacggtct cggtgggcct gctcggcctg       120
     gccatgccgc cgatgcaggc ggcggcgctg ctgatcgtac cgtcgatggt gaccaacctc       180
     tggcagctcg cctgcggccc gcgcttcctc ggcttgatga agcgcctggc cggcctgctg       240
     ctcggggtgg tcgtgggcac cctgctggtc ggcgcatggc tcggcggcga cgcaccaagg       300
     caggccaccg gcgtgctcgg cctggccctg gcggcctacg cgctgctcgg cctggccgcg       360
     atcccgctgc acctgccggc acgccacgag ccctgggccg gcccgctggt cgggctggcg       420
     accggcgcgc tgaccgcggt caccggggtt ttcgtgattc ccgcggtgcc ctacctggga       480
     gccctacgat tgcagcgcga cgaactggtc caggccctcg gcctgtcgtt cagcgcctcg       540
     accctggccc tggcggtcac tctcggcgtg cacggcgacc tgctcgaacc gcagatgctc       600
     ggcgcctcgc tgctgaccct ggtcccggcg ctgggcggga tgctcctcgg ccagtggctg       660
     cgccagcgga tcagcgcgac gctgttcagg cgctgcttct tcgtcggtct cctgctgctc       720
     ggcgccgacc tcgcctggcg cggtttccac tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page