(data stored in ACNUC7421 zone)

EMBL: CP000438.PE30

CP000438.PE30        Location/Qualifiers
FT   CDS_pept        complement(32081..33004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00360"
FT                   /product="putative glycine betaine/L-proline ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14986"
FT                   /db_xref="GOA:A0A0H2ZJZ0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ0"
FT                   /protein_id="ABJ14986.1"
FT                   /translation="MNRLPTCLLAATLFLGSASLYAEDPACARVRLADPGWSDIAVTNA
FT                   TAAFLLESLGYQVKIDTLSVPIIYGGLRDGQVDAFLGGWMPAHQDYHDKFVASGQVERL
FT                   ARNLDGTRFTLAVPRYVWDAGVHRFEDLAAQGQRFNRKLYGIGSGAPANQSIQKMIDAN
FT                   QFGLGDWKLVESSEQAMLAELGRAEKRQRWLVFLGWTPHPMNIRHDLRYLEGGEQYFGD
FT                   RGQVYTLARKGYAAQCPNPARLLANLRFDLDMENRLMSDALEGTATPASATRAWLKANP
FT                   RVLEAWLQGVTSRDGGDALAAVRGQP"
     atgaaccggc ttcccacctg cctgctggcc gccaccctgt tcctgggcag cgcctcgcta        60
     tacgccgaag accccgcctg tgcccgcgtc aggctggccg atccaggctg gagcgatatc       120
     gcggtgacca acgccaccgc cgcgtttctc ctggaaagcc tcggctacca ggtgaagatc       180
     gataccctgt cggtgccgat catctatggc ggcctgcgcg acggccaggt ggacgccttc       240
     ctcggcggct ggatgcccgc gcaccaggac tatcacgaca agttcgtcgc cagcggccag       300
     gtcgaacgcc tcgctcgcaa cctcgatggc acccgcttca ccctggcggt gccgcgctac       360
     gtctgggacg ccggcgtaca ccgcttcgaa gacctcgccg cgcaagggca acgcttcaac       420
     cgcaagctgt acgggatcgg ctccggcgcg ccggccaatc agtcgatcca gaagatgatc       480
     gacgccaacc agttcggcct cggcgactgg aagctggtgg agtccagcga gcaggcgatg       540
     ctcgccgaac tcggccgggc cgagaagcgc cagcgctggc tggtgttcct cggctggacg       600
     ccgcacccga tgaacatccg ccatgacctg cgctacctgg aaggcggcga gcagtacttc       660
     ggcgaccgcg gccaggtcta taccctggca cgcaagggct acgccgcgca gtgcccgaac       720
     ccggcgcggc tgctggccaa cctgcgcttc gacctggaca tggagaaccg cctgatgagc       780
     gacgcgctgg aaggcacggc gactccggcc tcggcgaccc gcgcctggct caaggccaac       840
     ccgcgggtgc tcgaggcctg gctgcaaggg gtgaccagcc gcgacggcgg cgacgccctg       900
     gccgcggttc gcggccagcc atag                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page