(data stored in ACNUC7421 zone)

EMBL: CP000438.PE304

CP000438.PE304       Location/Qualifiers
FT   CDS_pept        339852..340823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03790"
FT                   /product="putative sensory box/GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15253"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT9"
FT                   /protein_id="ABJ15253.1"
FT                   /translation="MDDLPGIPEDPQEAALALLHSRAEVARLKEREQLFSALLASVNSV
FT                   LWAYDWQNRRMVYVSPAYEKIFGRSAALLLADYEEWRNSIYPDDLDYADSSLLQVLERG
FT                   AVEQREYRIVRGDGEVRWLNDKCFVSRQGEAGLPLMVVGIAEDITDKKHMESELQRLAT
FT                   TDVLTQSSNRRYFFDSAEAAFKECRREGIPLAFLLLDVDDFKKINDRFGHQVGDQVLQR
FT                   IAQSGSAALRRGDLFGRIGGEEFAVLLPGCDEQTARQIGERLQREVQRLRFQEGEQSFG
FT                   ITVSQGLTVLQADDEGLGALYSRADAAMYSAKRQGKDCIVVG"
     atggacgacc tacccggcat tcccgaagac ccgcaggagg ccgcgctggc cttgctgcac        60
     agccgtgccg aagtggcccg gctgaaggag cgcgagcaac tcttcagcgc cttgctggcc       120
     agcgtcaact cggtgctctg ggcctacgac tggcagaacc ggcggatggt ctacgtcagc       180
     cccgcctacg agaaaatctt cggccgttcc gcggcgctgc tgctggcgga ctacgaggag       240
     tggcgcaaca gcatctaccc ggacgacctc gactacgccg acagcagcct gctgcaggtg       300
     ctcgaacgtg gcgccgtgga acaacgcgaa taccgcatcg tgcgcggcga cggcgaggtc       360
     cgctggctca acgacaagtg cttcgtcagt cgccagggcg aggcgggact gccgctgatg       420
     gtggtgggca tcgccgagga catcaccgac aagaagcaca tggagagcga gctgcaacgg       480
     ttggccacca ccgacgtgct gacccagagc agcaaccgtc gctatttctt cgacagtgcc       540
     gaggcggcct tcaaggagtg tcgccgcgag gggataccgt tggcgttcct gctgctggac       600
     gtcgatgact tcaagaagat caacgaccgc ttcggccacc aggtcggcga ccaggtcctc       660
     cagcgtatcg cccagagcgg cagtgccgcg ttgcgccgtg gcgacctgtt cgggcggatc       720
     ggcggcgagg agttcgccgt gctgctgccc ggctgcgacg agcagaccgc gcgacagatc       780
     ggcgaacgcc tgcagcgcga ggtgcaacgc ctgcgcttcc aggagggcga acaaagcttc       840
     gggatcaccg tcagccaggg cctgacggtc ctccaggctg atgacgaggg gctcggtgcc       900
     ctctacagcc gggccgacgc cgcgatgtac tcggccaagc gccagggcaa ggactgcatc       960
     gtcgtgggct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page