(data stored in ACNUC7421 zone)

EMBL: CP000438.PE309

CP000438.PE309       Location/Qualifiers
FT   CDS_pept        complement(345887..346948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03855"
FT                   /product="probable periplasmic polyamine binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03855"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15639"
FT                   /db_xref="GOA:A0A0H2ZM12"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZM12"
FT                   /protein_id="ABJ15639.1"
FT                   /translation="MPRLSALLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTG
FT                   IRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHLDR
FT                   QLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKS
FT                   CGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYIADLE
FT                   GGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPAGAQHPREAHRFIDYL
FT                   MQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLRPV
FT                   VDEIWKAFRGASH"
     atgccccgcc tttccgccct gctgttcctc gccctcgcac cctggctggc ccaggccgag        60
     gagaccctgc gcgtctacaa ctggaacgac tacatcgacc cgcaggtgct cgagtccttc       120
     cagaaggaca ccggcatccg cgtcgagtac cacaccttcg ccaccgccga ggaactggac       180
     aaggcgctgc gcagtggcga ggcgatcgac gtcgccgtcc cctcccacga caccctgccg       240
     gccctgctga aggacaacct gctgcggccg ctggacttca cccagctgcc caaccgcagc       300
     catctcgacc gtcaattgct gagcaaactg gccgcggtcg accctgacaa ccgccacgcc       360
     gtcccctatc tatggggtgc cgtaggcctg gccatcaata ccccgcaggc cgaagccgcc       420
     tatggcgggc cgctgcccaa cagctggagc ctgctgttcg acgccagcca gagccagcgc       480
     ctgaaaagct gcggcatcag cctgctggac gcgccggacg aaaccctggc gatcctcctc       540
     aactaccagg gccgcaacct cggtcgtacc gctccgagcc aggtacgccg cgccgccgag       600
     gcgctgcacg gactgcgacc gaacctgcgc tacgtcgaca gcgagcgcta catcgccgac       660
     ctcgaaggcg gtcgcctctg cctggccatg gcctgggtcg gcgacgccct gcgcgcggcc       720
     aaggcgggcc agccggtaag tttcgaggta ccgcaggaag gctcggtgct gttcatcgac       780
     aacctggtga tcccggccgg cgcccagcat ccacgcgagg cgcaccgttt catcgactac       840
     ctgatgcaac cgaagatcgc cgcacagatc accgccgcca ccctctaccc cagcggcaac       900
     gccgacgccg ccggcttcct cgatcccgcc ctgcgccagc aacccggcct gtatccggac       960
     cgcgacacca gccgccgcct gttcgccctg gaaacgccgc cggaaaaact ccggccggtg      1020
     gtcgacgaga tctggaaggc cttccgcggc gccagccact ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page