(data stored in ACNUC7421 zone)

EMBL: CP000438.PE321

CP000438.PE321       Location/Qualifiers
FT   CDS_pept        complement(361977..362480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB4"
FT                   /protein_id="ABJ15269.1"
FT                   /translation="MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLAD
FT                   VDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVSD
FT                   DQASTLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQV
FT                   PLVE"
     atgtccctac gtcccaccct cgccctgctc gccctcgtca gcctgccgct gatggccgcc        60
     cagaacgacc ctcagcccag cagcaaggaa ctgatgaagg agcaccaggc gcagatccag       120
     aacgacctgg ccgacgtcga ctacaagcgc aagcgcatcg tcgaggccaa catgaacctc       180
     accgaccagg aaggcgagaa gttctggccg atctacaaca cctaccgcac cgagtcggac       240
     aagctcagca aggaaaccct caagctcctg ctcgactacg cccaggccta caacagcggc       300
     aacgtcagcg acgaccaggc gagcacgctg atcgagcgtg tcgacgacct ccaggaggac       360
     cgcctggaac tgcgcgacaa gtacgtcaag cgcatcgcca agaacgtctc gcccaagcgc       420
     gccatgcgct tcctgcagat cgagatccag ctcgacgcca tcgccaccct ggagatcggc       480
     cgtcaggtac cgctggtcga gtaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page