(data stored in ACNUC7421 zone)

EMBL: CP000438.PE322

CP000438.PE322       Location/Qualifiers
FT   CDS_pept        complement(362585..363196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15271"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU0"
FT                   /protein_id="ABJ15271.1"
FT                   /translation="MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYI
FT                   RPFSEQTTLFSGDSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGV
FT                   EFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAV
FT                   CTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG"
     atggcaagct tggcacccgt tttccgtgtg aatgccatga ctccccgccg caagacgctc        60
     ctcgtcagcc tggtcggcct gctctgggcc ggcggcctgc tcgccgccta ctggtggttc       120
     gagatccgct acatccgccc gttcagcgag cagaccaccc tgttctccgg cgacagcctg       180
     cgcctgccgg ccgagctggc cgggccgggg gcgatccgcc tggtgcattt ctgggacccg       240
     gcctgcccct gcaacgtcgg caaccagcag cacctcggcg agctgatcga acgcttcgcc       300
     ggcaagggcg tggagttcca tgtcctgcag aagcctggca gccagggccg cctgccggac       360
     aacctggccg ccctgcgccc cctcgccggt ctgcccggtt ccgagcagtt gccggccagc       420
     ccggccgtgg cgatctggga ccgcgacggc cgcctggcct acttcggccc ctatagcgag       480
     ggcgcggtat gcacctccag caacagcttc atcgaaccga tcctcgaagc gctgctgcag       540
     ggacgtccgg tggatgccac ccataccctc gccgtgggtt gctactgccc ctggaccccg       600
     gaaaaaggct ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page