(data stored in ACNUC7421 zone)

EMBL: CP000438.PE324

CP000438.PE324       Location/Qualifiers
FT   CDS_pept        complement(364234..364986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN8"
FT                   /protein_id="ABJ15272.1"
FT                   /translation="MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQ
FT                   KRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVV
FT                   AAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADS
FT                   LSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQYVNFA
FT                   ESPSGRSYYQAALAALKAGLAVDQAVAP"
     atgcgcgctt tgctcgcctt cgctttactg ctggttggtc tgcccgccct ggccgaccct        60
     tatcaacgcc tgtaccaggc cgctggctgg cccgaccagc gcgcgcattt cagcgatgcc       120
     ctggacgcgg cgcagaagcg ctaccaggac aagctgccac ccgcgctcta ccagaccctg       180
     gtggacaaca gcaatcgccg cttcgccccg gccgaagtcg accagcgcgc cctcaacggc       240
     ctgcgcgaga acctgccgga cagcgccagc ccgctgaatt tcttcgagtc gccgctgggg       300
     cgcaaggtgg tcgccgccga ggtgctcgcc acccgccgcg accagttgct ccagcacagc       360
     aacggcctgc cgcggcagac cgccagcgag ccgcgccggg ccctggtgaa gcgcctggcc       420
     caggtccttc cggcccgaga ggccggtgcg gaagtcagcc tggccctggc cggggtcgcc       480
     gccgacagcc tcagccaaat gcttccgggc ctccccggcc tgcttggcgg cggacagacc       540
     ggccagttgc tggaaggcca gcgccagcgc ctggtgcagc agatcggcgc ggacctggag       600
     aacaccctgc tgtatgtcta ccgcgatctc tccgacgcgg aactcaccca gtacgtgaac       660
     ttcgccgagt cgccgtccgg ccgcagctac taccaggcgg ccctggccgc gctgaaagcc       720
     ggcctggcgg tggaccaggc ggtcgccccc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page