(data stored in ACNUC7421 zone)

EMBL: CP000438.PE326

CP000438.PE326       Location/Qualifiers
FT   CDS_pept        complement(365755..366309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15274"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB9"
FT                   /protein_id="ABJ15274.1"
FT                   /translation="MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISL
FT                   RLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLPIF
FT                   GVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNS
FT                   IGRIELRDITDLRGTIKVWGH"
     atgctcccga cccgctcgct tctaccgttt ttcctggccc ccgcgctgct cgccagcgct        60
     gccagccagg cggccatgga ggccctggac aacgacagtc tcagccaggt caccggccag       120
     gccggcatca gcctgcgcct ggacctgcgc gccggcgcgg ccagggtcgc ctgggtggac       180
     gacggcggca gcctctcgct gcgcaacctg gtgatcgaca acggctgcgt gaaggccggc       240
     gactgcccgg acgggcgcgg cggcaacatc cccctgggcg ccgcccagct cggcctgagc       300
     ctgccgatct tcggcgtcga gcagccgacc ctggcactgg acgtgaccac cggcagcggc       360
     ggcgggcagc aactggcgat cagcctgccg gacctcgcca ccatcaacga ccagttgatc       420
     gccagcggcc tgccggcgca gcgcatccgc ctgcgggtgg ccagcgacct gtacatcggc       480
     gacaactcga tcggccgcat cgaactgcgc gacatcaccg acctgcgcgg cacgatcaag       540
     gtctggggtc actga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page