(data stored in ACNUC7421 zone)

EMBL: CP000438.PE327

CP000438.PE327       Location/Qualifiers
FT   CDS_pept        366575..367069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15275"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW0"
FT                   /protein_id="ABJ15275.1"
FT                   /translation="MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVA
FT                   GGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAV
FT                   LKARSPSCGNLENYDGRFNGSRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAG
FT                   G"
     atgcagaagg ttctggtcag ccgttgcctg ctgggccacc tggtgcgcta cgacggtggc        60
     agccatggcc cgttcgacct gctctcgcgc tggcatgcgc aggggcggat cgtcgccctt       120
     tgcccggagg tcgccggcgg cctgccgacg ccccgcccgc cagcggagat ccccggcggc       180
     cagggcggcg aagtgctgga ccggctgaac cgggtcttca ccgtcgacgg cgaggatgtc       240
     agcgaagcat tcctgctggg tgcggaggcg gcagtggagc tggtccgccg ccatgacatc       300
     cggatggccg tgctcaaggc gcgcagtcct tcctgcggca acctggagaa ctacgacggg       360
     cgcttcaacg gcagccgggt cgccggcgag ggcgtcaccg ccgccgccct caagcgcatg       420
     ggcgtgctgg tcttcaacga agacgagctg gaccgcgccg cggtctgcct ggccggcctc       480
     gacgccggcg gctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page