(data stored in ACNUC7421 zone)

EMBL: CP000438.PE335

CP000438.PE335       Location/Qualifiers
FT   CDS_pept        374152..374502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15283"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL19"
FT                   /protein_id="ABJ15283.1"
FT                   /translation="MKLRHLPLIAAIGLFSTVTLAAGYTGPGATPTTTTVKAALEAADD
FT                   TPVVLQGTIVKRIKGDIYEFRDATGSMKVEIDDEDFPPMEINDKTRVKLTGEVDRDLVG
FT                   REIDVEFVEVIK"
     atgaaacttc gtcacctgcc cctcatcgct gccatcggcc tgttctccac cgtcaccctg        60
     gccgccggct ataccggccc gggcgctacc ccgaccacca ccacggtgaa ggccgcgctg       120
     gaagccgccg acgacacccc ggtggtcctc cagggcacca tcgtcaagcg catcaagggc       180
     gacatctacg agttccgcga tgccaccggc agcatgaagg tggagatcga cgacgaagac       240
     ttcccgccga tggaaatcaa cgacaagacc cgggtcaagc tgaccggcga agtcgaccgc       300
     gacctggtcg gccgcgagat cgacgtcgag ttcgtcgaag tgatcaagta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page