(data stored in ACNUC7421 zone)

EMBL: CP000438.PE337

CP000438.PE337       Location/Qualifiers
FT   CDS_pept        complement(375633..377027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04210"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15285"
FT                   /db_xref="GOA:A0A0H2ZJX0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX0"
FT                   /protein_id="ABJ15285.1"
FT                   /translation="MASQRNNGILIGGKRPEYVHSAQGTGLRRILGLPALVFFGLVYMV
FT                   PLTMFTTYGVVTEITGGRTASAYLITLAAMLFTAFSYSFMVKKYPIAGSAYSYTSLSFG
FT                   PCVGFLAGWSLLLDYLFLPMINYLLIGLFLNIAFPMVPAWVFVLTAIGLVTVLNVIGIS
FT                   SVAGMSNVIVGAQFVFAVVFVAMAVKHLAGIPSLDLSLPFVGDGSQPGFAPLMAGAAVL
FT                   CLSFLGFDAVSTLAEETRDPQRDIPRAIVITTVGAGLLFTVLAVFSQLVFPGSVFQDAE
FT                   SAANEVMLAAGGKFLASFFTAAYVAGAAGSALASQASVSRILYSMGRDGILPRRVFGSL
FT                   SERFKTPVIAILVVSVISLLAVVIDLTTLASMISFGALVAFSAVNLAVIRSYLLLDGRR
FT                   APRDLLRYGLVPAIGLGLTLWLWTSLSALTLVIGLTWFAAGLAYLALHTGGFRRKAPTV
FT                   TFSEQN"
     atggccagcc aacgcaacaa cggcatcctc atcggcggca agcgccccga gtacgtccac        60
     agcgcccagg gcaccggcct gcggcgcatc ctcgggctcc ccgccctggt cttcttcggg       120
     ctggtctaca tggttccgct gaccatgttc accacctacg gggtagtcac cgagatcacc       180
     ggcggtcgca ccgccagcgc ctacctgatc accctggcgg cgatgctctt caccgccttt       240
     tcctacagct tcatggtgaa gaaatatccc atcgccggct cggcctattc ctataccagc       300
     ctcagcttcg gcccctgcgt cggcttcctc gccggctggt cgctgctgct cgactacctg       360
     ttcctgccga tgatcaacta cctgctcatc ggcctgttcc tcaacatcgc cttcccgatg       420
     gtgccggcct gggtcttcgt gctcacggcg atcggcctgg tcaccgtgct caacgtgatc       480
     ggcatcagct cggtggccgg catgagcaac gtgatcgtcg gcgcccagtt cgtcttcgcc       540
     gtggtgttcg tcgccatggc ggtcaagcac ctggccggca tcccctcgct ggacctgagc       600
     ctgcccttcg tcggcgacgg cagccagccg ggcttcgccc cgttgatggc cggcgcggcg       660
     gtgctgtgcc tgtcgttcct cggcttcgac gcggtctcga ccctggccga ggaaacccgc       720
     gacccgcaac gcgacatccc gcgcgccatc gtcatcacca cggtcggcgc cggcctgctg       780
     ttcaccgtgc tggcggtctt cagccaactg gtgttccccg gcagcgtatt ccaggacgcc       840
     gagtcggcgg ccaacgaagt gatgctggcg gccggcggca agttcctcgc cagcttcttc       900
     accgccgcct acgtcgccgg cgccgccggc tcggcactgg cctcgcaggc ctcggtgtcg       960
     cgcatcctct acagcatggg ccgcgacggc atcctgccgc ggcgcgtgtt cggcagcctc      1020
     tcggagcgct tcaagacgcc agtgatcgcg atcctggtgg tctcggtgat ttccctgctg      1080
     gcggtggtca tcgacctcac caccctggcc tcgatgatca gcttcggcgc gctggtggcg      1140
     ttctccgcgg tgaacctggc ggtgatccgc agctacctgc tgctcgacgg ccgccgcgcc      1200
     ccgcgcgacc tgctgcgcta cgggctggtg ccggccatcg gcctgggcct gaccctgtgg      1260
     ctgtggacca gcctctcggc gctgaccctg gtgatcggcc tgacctggtt cgccgccggc      1320
     ctcgcctacc tggcgttgca taccggcggt ttccgccgca aggcgccgac cgtgaccttc      1380
     tccgaacaga actga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page