(data stored in ACNUC7421 zone)

EMBL: CP000438.PE338

CP000438.PE338       Location/Qualifiers
FT   CDS_pept        complement(377448..378491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04220"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15286"
FT                   /db_xref="GOA:A0A0H2ZKV5"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV5"
FT                   /protein_id="ABJ15286.1"
FT                   /translation="MTYRTPLTLLFAAGLALGGQARAEGTLHFANWSDYYPPELLKKFE
FT                   KDTGIKATLDAYDSNETLLAKLKAGGGAYDVVVPSDSFIEIFVKEGLLQKLDKSQLPSL
FT                   GNLKENFRTLGFDPGHDYSIPYLWGTTGYSYDTAKVPGGRLEESWKPFFEPPAELKGKV
FT                   VALNSIEELFIPATYYLGIDECTEDAREAQKVLDLLLRQKPALAMYNSDGTIERMAAGE
FT                   VAMHQQWNGAFHRAHAQRPSLEYVYPKEGIRLFIDNFAIPRDASNVKEAHVFIDWMMRP
FT                   ENIAAASNFAKYNNAIVGSEKFMEKALFDDPAINTPQDKLNRLKPFKLCSPKALALRSK
FT                   VWTKLKK"
     atgacctacc gcacaccgct caccctgctc ttcgccgccg gtctagccct gggcggccag        60
     gctcgcgccg aaggcaccct gcacttcgcc aactggtcgg actactaccc gccggagttg       120
     ctgaagaagt tcgagaagga caccgggatc aaggccaccc tcgacgccta cgacagcaac       180
     gagacgctgc tggccaagct caaggccggg ggcggcgcct acgacgtggt ggtgccgtcg       240
     gacagcttca tagagatttt cgtcaaggag gggctgctgc aaaagctcga caagagccag       300
     ttgccgagcc tgggcaatct gaaggaaaac ttccggaccc ttggcttcga tcccggccac       360
     gactacagca ttccctatct ctggggcacc accggctaca gctacgatac ggcgaaggtg       420
     ccgggcggca ggctggaaga aagctggaag ccgttcttcg aaccaccagc cgagctgaaa       480
     ggcaaggtgg tggcgctgaa ctccatcgag gaactgttca ttcccgccac ctactacctc       540
     ggcatcgacg aatgcaccga ggacgccagg gaagcgcaga aggtcctcga cctgctgctc       600
     aggcaaaagc cggcgctggc catgtacaac agcgacggca ccatcgagcg catggccgcc       660
     ggcgaggtcg ccatgcacca gcagtggaac ggcgccttcc accgcgccca cgcccaacgc       720
     cccagcctcg aatacgtcta tccgaaggaa ggcatccggc tgttcatcga caacttcgcg       780
     attccgcgcg acgccagcaa cgtcaaggaa gcccacgtct tcatcgactg gatgatgcgc       840
     ccggagaaca tcgccgccgc ctccaacttc gccaagtaca acaacgccat cgtcggctcg       900
     gagaaattca tggagaaggc gctgttcgac gacccggcga tcaacacccc gcaggacaag       960
     ctcaaccgcc tgaagccgtt caagctctgc tcgccgaaag ccctggcgct gcgcagcaag      1020
     gtctggacca agcttaagaa atga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page