(data stored in ACNUC7421 zone)

EMBL: CP000438.PE34

CP000438.PE34        Location/Qualifiers
FT   CDS_pept        complement(35926..36291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00420"
FT                   /product="putative histidine phosphotransfer domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14990"
FT                   /db_xref="GOA:A0A0H2ZJV3"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJV3"
FT                   /protein_id="ABJ14990.1"
FT                   /translation="MRTFDLTAALGDRANQPEISRLLVAQLMTSNNEDTRKLRRAQERE
FT                   QTQELNELAHRLAGMASLIHAHAVERACHQLEIACGESSVRKLADAVDDLVTALGELQC
FT                   ELHDWMTMTAPQGTAKS"
     atgcgaacgt tcgacctgac cgccgccctg ggcgaccgcg ccaaccaacc ggaaatcagc        60
     cgcctgctcg tcgcgcagct gatgaccagc aacaacgaag acacccgcaa gctgcggcgc       120
     gcccaggagc gcgagcagac ccaggaactc aacgagctgg cgcaccgcct ggcgggcatg       180
     gcctcgctga tccacgccca cgccgtggaa cgcgcctgcc accaactgga gatcgcctgc       240
     ggcgaaagct ccgtgcgcaa gctcgccgat gccgtcgacg acctggtgac ggcactgggc       300
     gagctgcaat gcgaactgca cgactggatg acgatgaccg cgcctcaagg cacggcgaag       360
     tcatag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page