(data stored in ACNUC7421 zone)

EMBL: CP000438.PE343

CP000438.PE343       Location/Qualifiers
FT   CDS_pept        complement(382631..384574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04290"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15291"
FT                   /db_xref="GOA:A0A0H2ZKW1"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW1"
FT                   /protein_id="ABJ15291.1"
FT                   /translation="MFKPLAVAVGLGCAALSLGANAYQYGEYAGETLERLITDYPGRYR
FT                   GTASFAGASELMQSRLGFGYQTSRQDFTWAGNRSSQNVIASAPGSSGKFLVLGAHYDTY
FT                   YGRPTLQGLDDNASGAAVLTEIARNLGGIALENGLEVVGFGAEEEGLRGSRAYVESLDA
FT                   SQRANLLGMINLDSLVTGDKMYAHAGSNSVSNPALGAYREQILRIARELDIPLFTNPGL
FT                   NAEYPAGTGCCSDGESFNGMDIPVLFIEATNWELGDLDGYEQTDNPAIPGGSTWHDPAE
FT                   DNKEVLTNALGQERIEQRMRDFSRLLTRLVLELTNADLLASTASGGALARQMEDQLQRQ
FT                   HQALTRLHDRRWLTLLGSNRPVGSFDGEVGAEGEVSPDSGFDMPGDPESRRAGVHLLGD
FT                   YRYSEALTLGGSLAFQRSRDKLDHGGRIEGDTWQLGLFGLYNDGGPEWLAGELNLGHTR
FT                   YDSKRSVYLQAAGGPVLLDQRLSGDTSAWSWGARLEGGYDFSFGELRSGPLAGLDYMRY
FT                   RIDDFREDEALRTALGYEKQDYDSLEASLGWRLRGELALGARMRLQPYASLRWVRELAD
FT                   GRLEDMDLTSRGDGRVRVADMGGVDKDFGRAQLGAQLAITEQLGVFAEANSRFAHSEGN
FT                   QAGYSLGVNWQF"
     gtgttcaaac cattagctgt cgctgtaggc ctgggatgtg ctgcgctgtc gttgggtgcc        60
     aacgcctatc aatacgggga atacgccggg gagaccctgg agcgcctgat caccgactac       120
     ccgggccgct atcgcggcac cgccagcttc gccggcgcca gcgaactgat gcagtcgcgc       180
     ctgggcttcg gctaccagac cagtcgccag gacttcacct gggccggcaa ccgcagttcg       240
     cagaacgtca tcgcctcggc gcccggcagc agcgggaagt tcctggtact cggcgcgcac       300
     tacgacacct actacggtcg cccgaccctg cagggcctgg acgataacgc ctcgggcgcg       360
     gcggtgctca ccgagatcgc ccgcaacctc ggcggcatcg ccctggagaa cggcctcgag       420
     gtggtcggtt tcggcgccga ggaggaaggc ctgcgcggtt cgcgtgccta cgtcgagtcc       480
     ctcgacgcca gccagcgcgc caacctgctg ggaatgatca acctcgacag cctggtcacc       540
     ggcgacaaga tgtacgccca tgccggctcc aacagcgtgt ccaacccggc cctcggcgcc       600
     taccgcgaac agatcctgcg catcgcccgc gagctggaca tcccgctgtt caccaacccc       660
     ggcctgaacg ccgaataccc ggcgggtacc ggctgctgca gcgacggcga aagcttcaac       720
     gggatggaca tcccggtgtt gttcatcgag gcgaccaact gggaactggg cgacctggac       780
     ggctacgagc agaccgacaa cccggcgatt cccggcggct caacctggca cgacccggcc       840
     gaggacaaca aggaagtact gaccaacgcc ctcggccaag agcgcatcga gcaacgcatg       900
     cgcgactttt cccgcctgct gacgcgcctg gtgctggagc tgaccaacgc cgacctgctg       960
     gcctccaccg cctccggcgg cgccctggcg cggcagatgg aagaccagtt gcagcgccag      1020
     caccaggcac tgacccgcct gcacgaccgc cgctggctga ccctgctcgg cagcaaccgg      1080
     ccggtaggca gcttcgacgg cgaggtgggc gcggagggcg aggtctcgcc ggacagcggt      1140
     ttcgacatgc ctggcgatcc ggagtccagg cgcgccggcg tgcatctgct cggcgactac      1200
     cgctacagcg aggccctgac cctcggcggc agcctggcct tccagcgcag ccgcgacaag      1260
     ctggaccatg gcgggcgcat cgagggcgac acctggcagc tcggcctgtt cggcctgtac      1320
     aacgacggcg gtccggaatg gctggccggc gagctgaacc tcgggcatac ccgctacgac      1380
     agcaagcgtt cggtctacct ccaggccgcc ggcgggccgg tgctgctcga ccagcgtctg      1440
     tcgggcgaca cctcggcctg gtcctggggc gcccggctgg aaggcggcta tgacttcagc      1500
     ttcggcgaac tgcggagcgg gccgctggcc ggtctcgact acatgcgcta ccgcatcgac      1560
     gacttccgcg aggacgaggc cctgcgtacc gcactcggct acgagaagca ggactacgac      1620
     tcgctggagg cgagcctcgg ctggcgcctg cgcggcgagc tggcgctggg tgcgagaatg      1680
     cgcctgcaac cctacgccag cctgcgctgg gtccgcgagc tggcggacgg acgcctggag      1740
     gacatggacc tgaccagccg cggcgacggg cgtgtccggg tcgccgacat gggcggcgtg      1800
     gacaaggatt tcggccgcgc ccagcttggc gcgcaactgg cgatcaccga gcagctcggg      1860
     gtcttcgccg aagccaacag ccgcttcgcc cacagcgaag gcaaccaggc gggctattcg      1920
     ctcggggtga actggcagtt ctga                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page