(data stored in ACNUC7421 zone)

EMBL: CP000438.PE344

CP000438.PE344       Location/Qualifiers
FT   CDS_pept        complement(384875..385207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15292"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKQ5"
FT                   /protein_id="ABJ15292.1"
FT                   /translation="MAAKFHLKKAKDGQFHFNLHAANGEIILTSELYKAKDSALGGIES
FT                   VRKNSQRDGAFEVKPANNGKFHFVLKATNGQVVGQSQLYASQANAEAGVQSVKRAAPEA
FT                   GLSDES"
     atggcagcca aattccatct gaagaaagcg aaagacggcc agttccactt caacctgcat        60
     gccgccaacg gcgagatcat tctcaccagc gaactgtaca aggccaagga ctcggcgctc       120
     ggcggcatcg agtcggtgcg caagaactcc cagcgcgacg gtgccttcga ggtcaagccg       180
     gccaacaacg gcaagttcca cttcgtgctc aaggccacca atggccaggt cgtcggccag       240
     agccagctct atgccagcca ggccaacgcc gaagccggcg tgcagtcggt gaagcgcgca       300
     gcgccggaag ccggcctcag cgacgaaagc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page