(data stored in ACNUC7421 zone)

EMBL: CP000438.PE347

CP000438.PE347       Location/Qualifiers
FT   CDS_pept        387894..388361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04330"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15295"
FT                   /db_xref="GOA:A0A0H2ZKD8"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD8"
FT                   /protein_id="ABJ15295.1"
FT                   /translation="MEHFLQIKILHGVATVLLFGGLLGLAFYAWRSWRTGDAARIARGF
FT                   KRVRLIGWPLLGLSLLALPVSGWWLVHLAGWPLGQSWLLFGACLYLLGCIFWLVLAGRL
FT                   ARVQHQAGAAETAGAALGEQTLREIKVGLVMALLGAASFIAVAVLMVSKPL"
     atggaacatt ttctccagat caagattctc cacggagtcg ccaccgtgct gctcttcggc        60
     ggcctgctcg gcctggcgtt ctacgcctgg cgcagctggc ggacgggcga cgcggcgcgg       120
     atcgcgcgcg gtttcaagcg ggtccgcctg atcggctggc cgctgctggg gctcagcctg       180
     ctggccctgc cggtcagcgg ctggtggctg gtgcacctgg ccggctggcc gttgggccag       240
     agctggctgc tgttcggcgc ctgcctctat ctgctcggct gcatcttctg gctggtcctc       300
     gccggccgcc tggcgcgggt ccagcaccag gccggcgccg ccgagacggc gggggccgcg       360
     ctgggcgagc agaccctgcg cgagatcaag gtgggcctgg tcatggccct gctcggtgcg       420
     gccagcttca tcgcggtggc ggtactgatg gtcagcaagc cgctctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page