(data stored in ACNUC7421 zone)

EMBL: CP000438.PE349

CP000438.PE349       Location/Qualifiers
FT   CDS_pept        389680..390147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04350"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15297"
FT                   /db_xref="GOA:A0A0H2ZKW5"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW5"
FT                   /protein_id="ABJ15297.1"
FT                   /translation="MNLYLLLKTLHILSSTILFGTGLGSAYYALRAWRSGQLPVIAVTF
FT                   RHLVTADWLFIATTAVFQPLSGLAMVHVAGWSLAQGWLLWSLGLYVFAGLCWLPVVWLQ
FT                   IRVRDMAEAALREARPIEPLAYRYMNAWFILGWPAFIAFMVIFYLMVNKPV"
     atgaaccttt acctactgct gaagaccctg catatccttt cctcgaccat tcttttcggc        60
     accggcctgg ggtcggccta ctacgccctg cgtgcctggc gcagcgggca gttgccggtg       120
     atcgcagtga ccttccgcca cctggtcacc gccgactggc tgttcatcgc caccaccgcg       180
     gtgttccagc cgctcagcgg cctggccatg gtgcatgtcg ccggctggtc gctggcccag       240
     ggctggttgc tgtggagcct gggcctctac gtgttcgccg ggctctgctg gctaccggtg       300
     gtgtggttgc agatccgcgt acgcgacatg gccgaggctg ccttgcgcga ggcgcggccc       360
     atcgaaccgc tggcgtaccg ctacatgaac gcctggttca tcctcggctg gccggccttc       420
     atcgccttca tggtcatctt ctacctgatg gtcaacaagc cggtctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page