(data stored in ACNUC7421 zone)

EMBL: CP000438.PE354

CP000438.PE354       Location/Qualifiers
FT   CDS_pept        395075..396205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04420"
FT                   /product="putative sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15302"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY5"
FT                   /protein_id="ABJ15302.1"
FT                   /translation="MRRLRFPRKRIDCLPFGRGHWPVERARDCRKMDERASKPPGLLPL
FT                   SREDLEKTLRYALEIVSDGIWDWNIATNQVSRSAGWYLMLGYPPHSLPESVETWKNIIH
FT                   PEDYPRVMASFQAYLDGESPEYCEEYRCRTYSGDYLWISDRGRFVEFDERGEPRRMIGA
FT                   HHEIHQRKLVELELQQRNEELFDWNRRLEDLVAERTEALHRVNQALASKMAEAQRLSEI
FT                   DPLTELYNRRKFEQCLHHEWMRRQRHGRATALMMIDVDHFKRINDLFGHSTGDRVLVAF
FT                   GRLVASELREVDVLARWGGEEFILLLPETGLEAAAALAERLRQRVRSQSFEMGERLTAS
FT                   FGVGVLNDGETLDLLLCRVDDALYRAKQRRDCVACC"
     gtgcggcgct tacgctttcc ccgcaagcgt atagactgcc tgccattcgg tagaggccac        60
     tggccagtcg aacgtgcgag ggattgccgc aaaatggacg aacgggcgtc gaagccgcca       120
     ggtcttcttc cgctgtcacg cgaagacctt gagaaaaccc tgcgatatgc cctggagatc       180
     gtcagcgacg ggatctggga ctggaacatc gcgaccaacc aggtcagccg cagcgccggc       240
     tggtacctga tgctcggcta tccgccacat agcctgccgg agagcgtgga gacctggaag       300
     aacatcatcc atcccgagga ctatccgcgg gtgatggcca gcttccaggc ctacctcgac       360
     ggcgaaagcc cggaatactg cgaggaatac cgctgccgca cctacagcgg ggattacctg       420
     tggatcagcg atcgcgggcg tttcgtcgag ttcgacgagc gcggcgagcc acggcggatg       480
     atcggtgcgc accacgagat ccatcagcgc aagctggtcg agctggagtt gcagcagcgc       540
     aacgaggaac tgttcgactg gaaccggcgt ctcgaggacc tggtggccga gcgcaccgag       600
     gcgctgcacc gggtcaacca ggcgctggcc tcgaagatgg ccgaggccca gcgcctgagc       660
     gaaatcgatc cgctcaccga gctgtacaac cggcgcaagt tcgagcagtg cctgcaccat       720
     gaatggatgc gccggcagcg ccatggacgc gcgacggcac tgatgatgat cgatgtcgat       780
     cacttcaagc ggatcaacga cctgttcggc cactccaccg gcgatcgcgt gctggtcgcc       840
     ttcggccgcc tggtcgccag cgagctgcgc gaggtcgacg tgctggcgcg ctggggcggc       900
     gaggagttca tcctgctgct tccggaaacc ggcctggagg ccgcggcggc cttggccgaa       960
     cgcctgcgcc agcgggttcg ctcgcagtcc ttcgagatgg gcgagcggtt gaccgccagc      1020
     ttcggcgtcg gcgtgctgaa cgatggcgag accctcgacc tgctgctgtg ccgggtggac      1080
     gacgccctct atcgggccaa gcagcgtcgc gattgcgtgg cctgttgctg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page