(data stored in ACNUC7421 zone)

EMBL: CP000438.PE355

CP000438.PE355       Location/Qualifiers
FT   CDS_pept        complement(396209..396964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15303"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW9"
FT                   /protein_id="ABJ15303.1"
FT                   /translation="MCLIVFAWQPGHALPLLVAANRDEFYARPSLPLAAWEDAEGVFAG
FT                   RDLEAGGTWLGLGPAGRFAALTNVRDPSQALGKRSRGELVADFLRGGGNPADYLAQVAG
FT                   RAADYSGFNLLIGDRHQLWHYNPRVGPPRLLPAGVYGLSNAALDTPWPKLLKARAALAE
FT                   RLAEPHPQALLELLADAAPAADSQLPDTGVGLATERLLSSVFIASPSYGTRASSVVRVH
FT                   ADGTREMIERSFGPSGARLGEVSLVLPPG"
     atgtgcctga tcgtcttcgc ctggcaaccg gggcacgccc tgccgctgct ggtcgccgcc        60
     aaccgtgacg aattctatgc ccgcccgagc ctgccgctgg cggcctggga ggacgccgag       120
     ggggtattcg ccggacgcga cctggaggcc ggcggcacct ggctggggct cggcccggcc       180
     ggccgtttcg ccgccctgac caacgtccgc gatccgtcgc aggctctcgg caagcgctcc       240
     cgtggcgaac tggtggcgga cttcctgcgc ggcggcggca acccggccga ctacctggcg       300
     caggtcgccg ggcgcgctgc ggactattcc ggcttcaacc tgctcattgg cgatcgccat       360
     cagctctggc actacaaccc ccgcgtaggg ccaccgcgcc tgctgccggc gggggtctac       420
     gggctgtcca acgcggccct cgatacgccc tggccgaagc tgctcaaggc tcgcgccgcc       480
     ctcgccgagc ggcttgccga gccgcatccg caggccctgc tggagctgct ggccgacgca       540
     gcgccggccg ccgacagcca gttgccggat accggcgtgg gtctggccac ggaacgtctg       600
     ctctccagcg tgttcatcgc cagcccgagc tacggcactc gcgccagcag cgtcgtacgg       660
     gtacacgccg acggcacgcg ggagatgatc gagcgcagct tcgggccgtc cggcgcccgg       720
     ctcggcgagg tcagcctggt gctgccgcca ggctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page