(data stored in ACNUC7421 zone)

EMBL: CP000438.PE359

CP000438.PE359       Location/Qualifiers
FT   CDS_pept        complement(399726..400523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15307"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL35"
FT                   /protein_id="ABJ15307.1"
FT                   /translation="MPFVSYAQNLEDVRLWRALKLFPRGFYIDVGANHPRIDSVTLAFY
FT                   ERGWRGINIEPLPHLHRELERERPEDLNLNLAIGEREGRATLYEMAASGLSTLDPELAR
FT                   QRQAEGCTATPREVMVSTLDAICAAHVEGPIHFLKIDVEGLEGAVLRGLDLNRWRPWLI
FT                   LAETPFDHDPEWKAPLLAAGYRFVHFDGLNGYYLAEEQARLEGAFALPPNLLDDFQLCH
FT                   GHAMSHPVAPLEQALEQALQRAEDAERALRDWRALPWYRRLFG"
     atgcccttcg tttcctacgc gcagaacctg gaagacgtcc gactctggcg ggccctgaaa        60
     ctcttcccca gggggttcta catcgacgtc ggcgccaacc acccgcggat cgactcggtc       120
     accctggcgt tctacgagcg cggctggcgc ggcatcaaca tcgaaccgct gccccacctg       180
     caccgcgagc tggagcggga acggccggaa gacctcaacc tgaacctcgc cattggcgag       240
     cgcgaaggcc gcgccacgct ctacgagatg gccgcctcgg gtctctccac cctggacccc       300
     gagctagccc gccagcgcca ggccgagggc tgcacggcca ctccgcgcga agtgatggtc       360
     agcaccctgg acgcgatctg cgcggcccat gtcgaagggc cgatccactt cctcaagatc       420
     gatgtcgaag ggctggaagg cgcggtgctc cgcggcctcg acctgaaccg ctggcgcccc       480
     tggctgatcc tcgcggaaac cccattcgac cacgaccccg agtggaaagc gccgctgctc       540
     gccgcgggct accgtttcgt ccacttcgac ggccttaacg gctattacct ggcggaggaa       600
     caggcccgcc tggaaggcgc cttcgcgcta ccgccgaacc tgctggacga cttccagctc       660
     tgccatggcc acgccatgag ccatccggtc gcaccgctgg agcaggccct ggagcaggcg       720
     ctgcaacgcg cagaagatgc ggagcgggct ttgcgggact ggcgcgcgct tccctggtac       780
     cgccgcctgt tcggttga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page