(data stored in ACNUC7421 zone)

EMBL: CP000438.PE360

CP000438.PE360       Location/Qualifiers
FT   CDS_pept        complement(400558..401937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15308"
FT                   /db_xref="GOA:A0A0H2ZKE6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE6"
FT                   /protein_id="ABJ15308.1"
FT                   /translation="MTEPLILAVVGHTNTGKTSLLRTLTRDRGFGEVSHRPSTTRHVEG
FT                   ARLSVDGEALLELYDTPGLEDAIALLDYLDALERPGERLDGPERMARLLDSNEARGRFE
FT                   QEAKVVRQLLASDAGLYVIDAREPVLAKYRDELAVLAGCGRPLLPVLNFVASPQHREEE
FT                   WRAALARLGLHALVRFDSVAPPLDGERRLYESLALLLERARPQLDRLIADHETQAAARL
FT                   RAGQRLIAELLVDVAACRRLVPGGESAVQEATRDLHQQVRKREQACVEALLRLYAFARD
FT                   DARAADLPLLDGRWGDDLFNPETLRQLGIRLGGGVAAGAAAGAGIDLLVGGVTLGAAAA
FT                   LGALAGGAWQTVGHYGSRLLGKLKGARELTVNDAVLRLLALRQRQLLAALQTRGHAAIE
FT                   AIRLETPEDKQWREGKLPEALRKARAHPEWSSLNGRRVGGSDRQEQIDALAELLESGRG
FT                   E"
     atgactgagc cgctgatcct ggccgtggtc ggccacacca ataccggcaa gacctcgctg        60
     ctgcgcaccc tgacccgcga ccgcggattc ggcgaagtct cccatcgccc cagcaccacc       120
     cgccacgtcg agggcgccag gctgtcggtg gacggcgaag cgctgctgga actctacgac       180
     acgcccggcc tggaagacgc catcgccctg cttgactacc tggacgccct ggagcgcccc       240
     ggcgagcgtc tcgatggccc ggaacgcatg gcgcggttgc tggacagcaa cgaagcgcgc       300
     gggcgtttcg aacaggaagc caaggtggtc cgccagttgc tcgcctccga tgccgggctc       360
     tacgtgatcg acgcccgcga accggtgctg gccaagtatc gcgacgaact ggcggtgctt       420
     gccggctgcg gccggccgct gctgccggtg ctgaacttcg tcgccagccc gcagcatcgc       480
     gaggaggagt ggcgcgccgc cctcgctcgc ctgggcctgc acgccctggt gcgtttcgac       540
     agcgtggcgc cgccgctgga cggcgaacgg cgcctctacg agagcctggc gctgctgctg       600
     gagcgcgccc ggccgcaact cgaccggctg atcgccgacc atgagaccca ggccgccgcg       660
     cgcctgcgcg ccgggcaacg gctgatcgcc gaattgctgg tcgacgtcgc cgcctgccgg       720
     cgcctggtgc ccggcggcga aagcgccgtg caggaagcca cccgcgacct gcaccagcag       780
     gtgcgcaagc gcgagcaggc ctgcgtggaa gcgctgctgc ggctctacgc cttcgccagg       840
     gacgacgccc gcgccgccga cctgccgctg ctcgacggcc gctggggcga cgatctgttc       900
     aatccggaga ccctgcgcca actcggtatc cgcctcggcg gcggggttgc ggccggtgcc       960
     gcggccggcg ccggcatcga cctgctggtg ggcggcgtca cccttggcgc cgccgccgcc      1020
     ctcggcgccc tcgctggcgg cgcctggcag accgtcgggc actacggttc gcgcctgctc      1080
     ggcaagctca agggcgcccg cgagctgacc gtcaacgacg ccgtgctgcg cttgcttgcg      1140
     ctgcgccaac ggcagctcct ggcagccctg caaacgcgcg gccacgcggc gatcgaggcg      1200
     atccgcctgg agaccccgga ggacaagcag tggcgcgaag gcaagctgcc ggaagcactg      1260
     cgcaaggcgc gcgcgcatcc ggagtggtcg tcgctgaacg gcaggcgggt gggcggcagc      1320
     gaccgccagg aacagatcga cgcgctggcc gaattgctgg agagcggacg cggggaatga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page