(data stored in ACNUC7421 zone)

EMBL: CP000438.PE361

CP000438.PE361       Location/Qualifiers
FT   CDS_pept        complement(401930..403315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15309"
FT                   /db_xref="GOA:A0A0H2ZJZ2"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ2"
FT                   /protein_id="ABJ15309.1"
FT                   /translation="MSHTTHPGLDALWLTEAVRLREEQAGPLEDSEALRQALAQGGSLP
FT                   RRILTRAHWLGRREGLLDAQRTWRQGSRLALALLLVLALASGAGLAFAALGDGQRPVNV
FT                   FWALASLLGLHLLTLLGWALGLLAGGEAAGALGRLWLWLSGKLARDARAAHLAPALLVL
FT                   LGRRRLARWGLGALVHGLWLLGLLTALAMLLGLLATRRYGFVWETTILGSDTFIALTQA
FT                   LGALPALLGFPLPDAELIRASGDAALASEAARHAWAGWLVGVLLVYGVLPRALLGLFCL
FT                   WRWKRGLADLDLDLDDPGYSLLRERLMPASERLGVSDAAPDWLPEPQGGQSGQEAAGAV
FT                   LVAVELDDRRPWPPKLAEGVADAGILDDGQQRRRLLDQLTRYPPARLAIACDPRRSPDR
FT                   GTLALLGELARCAASTRIWLLQAPPGEALDSDRLGDWHTALERLQLPHGETSPLAWLET
FT                   GHD"
     ttgagtcaca cgacgcatcc cggcctcgac gccctctggc tgaccgaggc cgttcgcctg        60
     cgcgaggagc aggccggtcc gctggaagac agcgaggcgc ttcgccaggc gctggcccag       120
     ggcggttccc tgccgcgccg tattctcacc cgcgcccact ggctgggccg ccgcgagggc       180
     ctgctggacg cccagcggac ctggcgccag ggttcgcggc tggcgctggc cctgctgctg       240
     gtgctggccc tggccagcgg cgccggactg gccttcgccg cgcttggcga cggccagcgc       300
     ccggtcaacg tgttctgggc gctggccagc ctcctcggcc tgcacctgct gaccctgctc       360
     ggctgggccc tcggcctgct cgccggcggc gaggccgcgg gcgcgctcgg ccggctctgg       420
     ctgtggctca gcggcaagct ggcgcgcgat gcccgcgccg cgcacctggc gccggcgcta       480
     ttggtcctgc tcggccggcg ccggctggcg cgctggggcc tcggcgcgct ggtccacggg       540
     ctctggctgc tcggcctgct gaccgcgctg gccatgctcc tcggcctgct ggcgacccgc       600
     cgctacggtt tcgtctggga aaccaccatt ctcggcagcg ataccttcat cgccctcacc       660
     caggcgctcg gcgccctgcc ggcgttgctt ggcttcccgt tgccggacgc cgagctgatc       720
     cgcgccagcg gcgacgccgc cctggccagc gaagccgcac ggcacgcctg ggccggctgg       780
     ctggtaggcg tactgctggt ctatggggtc ctgccgcgcg cgctgctcgg tctgttctgc       840
     ctgtggcgct ggaaacgcgg cctggccgac ctcgacctgg acctcgacga cccaggctac       900
     agcctgctgc gcgaacgctt gatgccggcc agcgaacgcc tcggcgtcag cgacgcggcg       960
     ccggactggc taccggagcc gcagggcggc cagtccggcc aggaagccgc cggagcggtg      1020
     ctggtggcgg tggagctgga cgatcgccgg ccctggccgc cgaagctcgc cgaaggcgtc      1080
     gccgacgccg gcatcctcga cgacggccag cagcgccgtc gcctgctcga tcaactgacc      1140
     cgctacccgc cggcgcgcct ggccatcgcc tgcgacccgc gtcgctcgcc ggaccgcggc      1200
     accctggcac tgctcggcga actcgcccgc tgcgccgcca gcactcgcat ctggctgctc      1260
     caggctccgc ccggcgaagc gctcgacagc gaccgcctgg gcgactggca caccgccctg      1320
     gagcgcctgc aactgccgca cggcgagacc tcgccgctgg cctggctgga gaccggccat      1380
     gactga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page