(data stored in ACNUC7421 zone)

EMBL: CP000438.PE362

CP000438.PE362       Location/Qualifiers
FT   CDS_pept        403507..403869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX5"
FT                   /protein_id="ABJ15310.1"
FT                   /translation="MKVVRRYPLALLLGMAGALADELPDGSLLQRYGVQADQLPTLAAD
FT                   PPSRKEEKETPSRFRVEPEQPLVTFGVKDHKGVEPTGNLSIDAMHERDRRICRNIRRQA
FT                   LEKGKAQPFDGYIECP"
     atgaaggtag tacgccgata ccccctggcg ctgttgctgg ggatggcggg cgcgctggcc        60
     gacgagttgc ccgatggctc cttgctgcaa cgctatggcg tgcaggccga ccagttgccg       120
     accctggcgg cggatccgcc gtcgcgcaag gaggagaagg aaacgccgtc gcgcttccgg       180
     gtggagccgg agcagccctt ggtgaccttt ggcgtcaagg accacaaggg cgtggaaccc       240
     accggcaacc tgtcgatcga cgccatgcac gagcgcgatc ggcggatctg ccggaacatc       300
     aggcggcagg cgctggagaa gggcaaggca cagcccttcg acggctacat cgagtgtcca       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page