(data stored in ACNUC7421 zone)

EMBL: CP000438.PE364

CP000438.PE364       Location/Qualifiers
FT   CDS_pept        405267..406361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL38"
FT                   /protein_id="ABJ15312.1"
FT                   /translation="MASAQPASAFPCLSLQLACLLLGAWLAFDAHGGGQAVAPPARVEA
FT                   RVPTAATDDWGRQPDSLMSAVPPRTLEASVGARGSGSASSRLWIADTDFRLHDDIGFFI
FT                   QRMLIRMEPTRPGAPLSLDDPTAMVARIQAGEIFVSDATLATLLNQDLAASRAAVRNLR
FT                   MSTRKDGQEVRGELLRKGRWRPLRMLTEIELSGPLEVTLVPRRIFVDGVEVTSSLAAAS
FT                   IEMSEVLKLKTRHMELVGNRIRVDLDGLFPPPRLDFRVSRLALADGGMQLALGDSLADL
FT                   QWPALRAPDSYMFIEGGDIKMARTVLVKAYALFTSLSPGQPLLFNLYDYRRQLQNGVIR
FT                   LREDGMVQIAVSPVKAPAPLEARL"
     atggcttccg cgcaacctgc ctccgcgttt ccctgcctgt cgttgcaact ggcctgcctg        60
     ttgctgggcg cctggctggc cttcgatgcc cacggtggcg gccaggccgt ggcgccgccg       120
     gcccgtgtcg aagcgcgtgt gccgacggcc gctaccgatg actgggggcg ccagccggac       180
     agcctgatga gcgccgtgcc gccgcgtacg ctggaggcga gtgtcggcgc ccgcggctcg       240
     ggatcggcga gttcgcgact gtggatcgcc gataccgact tccgcctgca cgacgacatc       300
     ggtttcttca tccagcgcat gctgatccgc atggaaccga ctcgtcccgg cgcgcccttg       360
     tcgctcgacg atccgacggc gatggtggcg cggatccagg ccggtgagat attcgtcagc       420
     gacgccaccc tggcgaccct gctcaaccag gacctcgccg cgtcccgcgc ggccgtgcgc       480
     aacctcagga tgagcacccg caaggacggc caggaagtgc gtggcgagtt gttgcgcaag       540
     gggcgctggc ggccgctgcg gatgctcacc gagatcgagc tgagcggtcc gctggaggtg       600
     accctggtac cccggcggat cttcgtcgac ggggtcgagg tcacttcgtc gctggcggcg       660
     gcctcgatcg agatgtccga ggtgctgaag ctgaagaccc ggcacatgga gctggtcggc       720
     aaccgcatcc gcgtcgacct cgacggtttg ttcccgccgc cgcgcctgga cttccgcgtc       780
     agtcgcctgg ccctggccga cggcggcatg caactcgccc tcggcgactc cctggccgac       840
     ctgcaatggc cggcattacg ggcgccggac agctacatgt tcatcgaggg cggcgatatc       900
     aagatggcgc gcaccgtgct ggtcaaggcc tacgccctgt tcaccagcct cagcccgggg       960
     cagccgctgc tgttcaatct ctacgactac cggcggcaac tgcagaacgg tgtgatccgc      1020
     ctgcgcgagg acggcatggt gcagatcgcc gtgtcgccgg tgaaggcgcc ggcgccgctg      1080
     gaggcacggc tgtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page