(data stored in ACNUC7421 zone)

EMBL: CP000438.PE365

CP000438.PE365       Location/Qualifiers
FT   CDS_pept        406358..407398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE9"
FT                   /protein_id="ABJ15313.1"
FT                   /translation="MSRRPWGVLLGWCLLAASAVQAESAIDRQQRELALLREGWYRQVP
FT                   PAPVPLPMRTAGPADSGQDGVGILLRNVDMYLRGNIGFHVPEVKGWLVPNRAGQPVDFD
FT                   RPQDIHFQVMEGEVLLSPRQLANLFNEHILAYDGTMLKDFRMSSAAGRLEVEGRVRPLG
FT                   VGPWLPLRLGGGVEVDAASGALVYRPDQLKVIGLPLYGAMSLVGLPMSALVSLDRPGAS
FT                   LVGSAMRLDYRKVFPLLGIDGHVQEAWLDDQGLHLRFSQAPGQPSPVFSPPAAAGPSFL
FT                   WLQSGDLKIFEILITYAQVLLKTETPDQVLTFNLQDYRKVLATGTTQVNEDGTFFMQVP
FT                   PYANPL"
     gtgagccggc gtccgtgggg cgtgctgctt ggctggtgcc tgttggcggc cagcgcggtc        60
     caggccgaaa gcgccatcga ccggcagcag cgcgaactgg ccctgctgcg cgagggctgg       120
     taccggcagg tcccgccggc gccggtgccg ctgcccatgc gtacggccgg gccggcggat       180
     tccggccagg atggcgtcgg catactgctg cgcaacgtgg acatgtacct gcgcggcaac       240
     atcggtttcc acgtgcccga ggtgaagggc tggctggtgc cgaaccgggc cggccagccg       300
     gtggacttcg atcgcccgca ggacattcat ttccaggtga tggagggcga ggtgctgctc       360
     agcccgcggc aactggccaa cctgttcaac gagcacatcc tcgcctacga cgggaccatg       420
     ttgaaggact ttcgcatgag cagtgcggcg ggacgcctgg aggtggaggg acgggtgcgt       480
     ccgctcggcg tagggccctg gctgccgctg cggctgggcg gcggcgtgga ggtggacgcg       540
     gccagcggcg cgctggtcta tcggcccgac cagttgaagg tgatcggtct gccgctgtac       600
     ggggcgatga gcctggtcgg cttgccgatg tcggcgctgg tcagcctcga tcggccgggg       660
     gcgagcctgg tcggcagcgc catgcgcctg gactaccgca aggtcttccc gctgctgggc       720
     atcgatggcc acgtacagga ggcctggctc gacgaccagg ggctgcacct gcgtttctcc       780
     caggcgcccg gccagccgtc gccggtgttc agcccgccgg ccgcggcggg cccatccttc       840
     ctctggctac agtccggcga cctgaagatc ttcgaaatcc tcatcaccta cgcccaggtg       900
     ctgctgaaga ccgagacccc ggaccaggtg ctgaccttca acctgcagga ctaccgcaag       960
     gtgctggcga ccggcaccac ccaggtcaac gaggatggca ccttcttcat gcaggtgccg      1020
     ccgtatgcca atcccttgta g                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page