(data stored in ACNUC7421 zone)

EMBL: CP000438.PE372

CP000438.PE372       Location/Qualifiers
FT   CDS_pept        414409..415233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04660"
FT                   /product="putative signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15320"
FT                   /db_xref="GOA:A0A0H2ZK04"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK04"
FT                   /protein_id="ABJ15320.1"
FT                   /translation="MPPQPQIMVDLQMEQVMPNPDLKNIARLISQDPGLSGALLKLVNS
FT                   PFFGLANRITSIQRAVNLLGSRSVINLINAQSIKGEMSDDTIVTLNRFWDTAQDVAMSC
FT                   LSLAKRVGYESVDEAYALGLFHNCGIPLMLKRFPHYMAVLEEAYAAASDKRRVVDTENR
FT                   VLNTNHAVVGYYTARSWRLPEHVCEAIANHHNALSIFGDESARDTQLKNLLAILKMAEH
FT                   ICGSHRILGNQPEDHEWNSIGALVLDYVGLTDYDFENLKGSILELGVGQGSY"
     gtgccgccgc aaccccagat catggtcgac ctgcagatgg agcaggtcat gcccaatccg        60
     gacctgaaga acatcgccag gctgatcagc caggacccgg gcctttccgg cgccctcctg       120
     aaactggtga actcgccgtt cttcggcctg gccaaccgca tcacttcgat ccagcgcgcg       180
     gtgaacctgc tgggcagtcg ttcggtgatc aacctgatca atgcccagtc gatcaagggc       240
     gagatgagcg acgacaccat cgtcaccctc aaccgtttct gggacaccgc ccaggacgtg       300
     gccatgagct gcctgagcct ggccaagcgg gtcggctacg agtcggtgga cgaagcctac       360
     gccctcggcc tgttccacaa ctgcggcatt ccgctgatgc tcaagcgctt cccgcactat       420
     atggcggtgc tggaggaggc ctatgccgcc gccagcgaca agcgccgggt ggtggacacc       480
     gagaaccgcg tgctgaacac caaccatgcg gtggtcggct actacaccgc gcgttcctgg       540
     cgcctgccgg agcacgtctg cgaggcgatc gccaaccacc acaacgcgct gtcgatcttc       600
     ggcgacgagt cggcccgcga cacccagctg aagaacctgc tggcgatcct gaagatggcc       660
     gagcacatct gcggctcgca ccggattctc ggcaaccagc cggaagacca cgagtggaac       720
     agcatcggcg cgctggtgct ggactacgtc gggctcaccg actacgactt cgagaacctc       780
     aagggctcga ttctcgagct gggcgtcggc cagggcagct actga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page