(data stored in ACNUC7421 zone)

EMBL: CP000438.PE375

CP000438.PE375       Location/Qualifiers
FT   CDS_pept        416842..417186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15323"
FT                   /db_xref="GOA:A0A0H2ZKS3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS3"
FT                   /protein_id="ABJ15323.1"
FT                   /translation="MNLFRTTALVLALTTGLSSMPALADAVQENASGDPMYTVEAPPAY
FT                   AMIGDLLIARPFLIAATAVGAVAFVVSLPFTAASGSVGKAGQALVVDPGKEAFVRCLGC
FT                   TTSGYNHDES"
     atgaacctgt ttcgcaccac cgcgctcgtg ctggcgctga ccaccgggct ctcgtccatg        60
     cccgcgctgg cggatgccgt gcaggaaaac gccagcggcg acccgatgta caccgtcgaa       120
     gcgccccccg cgtacgccat gatcggcgat ctgctcatcg cccgtccctt cctgatcgcc       180
     gccacggccg tcggggcggt ggccttcgtg gtcagcctgc cgttcaccgc ggccagcggc       240
     agcgtcggca aggccggcca ggcgctggtg gtcgatccgg gcaaggaagc cttcgtccgt       300
     tgcctgggct gcaccaccag cggctataac cacgacgaaa gctga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page